Recombinant Human SPON2 protein, T7/His-tagged
| Cat.No. : | SPON2-197H |
| Product Overview : | Recombinant human SPON2 cDNA (27–331aa, derived from BC036341) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 27-331 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFQPLGGESICSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSL LGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHAVFSAPAVPSGTGQTSAELEVQRRHS LVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPA NSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLG TKSRTRYVRVQPANNGSPCPELEEEAECVPDNCV |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | SPON2 spondin 2, extracellular matrix protein [ Homo sapiens ] |
| Official Symbol | SPON2 |
| Synonyms | SPON2; spondin-2; DIL1; M spondin; Mindin; DIL-1; MINDIN; M-SPONDIN; FLJ16313; FLJ22401; FLJ34460; DKFZp686G21139; |
| Gene ID | 10417 |
| mRNA Refseq | NM_001128325 |
| Protein Refseq | NP_001121797 |
| MIM | 605918 |
| UniProt ID | Q9BUD6 |
| Chromosome Location | 4p16.3 |
| Function | metal ion binding; receptor binding; |
| ◆ Recombinant Proteins | ||
| Spon2-213M | Recombinant Mouse Spon2 Protein, His-tagged | +Inquiry |
| SPON2-32HFL | Recombinant Human SPON2 Protein, Full Length, N-6×His tagged | +Inquiry |
| SPON2-5536H | Recombinant Human SPON2 Protein (Ser119-Val331), N-GST tagged | +Inquiry |
| SPON2-5718R | Recombinant Rat SPON2 Protein | +Inquiry |
| SPON2-5537H | Recombinant Human SPON2 Protein (Gln27-Val331), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPON2-1503HCL | Recombinant Human SPON2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPON2 Products
Required fields are marked with *
My Review for All SPON2 Products
Required fields are marked with *
