"SPON2" Related Products

Expand

Recombinant Human SPON2 protein, T7/His-tagged

Cat.No.: SPON2-197H
Product Overview: Recombinant human SPON2 cDNA (27–331aa, derived from BC036341) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFQPLGGESICSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSL LGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHAVFSAPAVPSGTGQTSAELEVQRRHS LVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPA NSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLG TKSRTRYVRVQPANNGSPCPELEEEAECVPDNCV
Purity: >90% by SDS-PAGE.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: SPON2 spondin 2, extracellular matrix protein [ Homo sapiens ]
Official Symbol: SPON2
Synonyms: SPON2; spondin-2; DIL1; M spondin; Mindin; DIL-1; MINDIN; M-SPONDIN; FLJ16313; FLJ22401; FLJ34460; DKFZp686G21139;
Gene ID: 10417
mRNA Refseq: NM_001128325
Protein Refseq: NP_001121797
MIM: 605918
UniProt ID: Q9BUD6
Chromosome Location: 4p16.3
Function: metal ion binding; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.