Recombinant Human SPTLC1, His-tagged
| Cat.No. : | SPTLC1-30887TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 221-473 of Human SPTLC1 with N terminal His tag; MWt 33 kDa , |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 221-473 a.a. |
| Description : | Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5-phosphate as a cofactor. The product of this gene is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in this gene were identified in patients with hereditary sensory neuropathy type 1. Alternatively spliced variants encoding different isoforms have been identified. |
| Conjugation : | HIS |
| Tissue specificity : | Widely expressed. Not detected in small intestine. |
| Form : | Lyophilised:Reconstitute with 148 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPEL VKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINID DIDLISANMENALASIGGFCCGRSFVIDHQRLSGQGYC FSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCGQIH KALQGISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQE IVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVEQ TEEELERAASTIKEVAQAVLL |
| Sequence Similarities : | Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. |
| Gene Name | SPTLC1 serine palmitoyltransferase, long chain base subunit 1 [ Homo sapiens ] |
| Official Symbol | SPTLC1 |
| Synonyms | SPTLC1; serine palmitoyltransferase, long chain base subunit 1; hereditary sensory neuropathy, type 1 , HSN1; serine palmitoyltransferase 1; hLCB1; HSAN1; LCB1; SPTI; |
| Gene ID | 10558 |
| mRNA Refseq | NM_178324 |
| Protein Refseq | NP_847894 |
| MIM | 605712 |
| Uniprot ID | O15269 |
| Chromosome Location | 9q22.31 |
| Pathway | Metabolic pathways, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, conserved biosystem; |
| Function | protein binding; pyridoxal phosphate binding; serine C-palmitoyltransferase activity; transferase activity; transferase activity, transferring acyl groups; |
| ◆ Recombinant Proteins | ||
| RFL13194PF | Recombinant Full Length Pongo Abelii Serine Palmitoyltransferase 1(Sptlc1) Protein, His-Tagged | +Inquiry |
| SPTLC1-2676Z | Recombinant Zebrafish SPTLC1 | +Inquiry |
| Sptlc1-6117M | Recombinant Mouse Sptlc1 Protein, Myc/DDK-tagged | +Inquiry |
| RFL68HF | Recombinant Full Length Human Serine Palmitoyltransferase 1(Sptlc1) Protein, His-Tagged | +Inquiry |
| SPTLC1-8694M | Recombinant Mouse SPTLC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPTLC1-1485HCL | Recombinant Human SPTLC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPTLC1 Products
Required fields are marked with *
My Review for All SPTLC1 Products
Required fields are marked with *
