Recombinant Human SPTSSB Protein, GST-tagged
| Cat.No. : | SPTSSB-5233H |
| Product Overview : | Human C3orf57 full-length ORF (BAG35080.1, 1 a.a. - 76 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Serine palmitoyltransferase (SPT; EC 2.3.1.50) catalyzes the first committed and rate-limiting step in sphingolipid biosynthesis. SSSPTB is a small SPT subunit that stimulates SPT activity and confers acyl-CoA preference to the SPT catalytic heterodimer of SPTLC1 (MIM 605712) and either SPTLC2 (MIM 605713) or SPTLC3 (MIM 611120) (Han et al., 2009 [PubMed 19416851]).[supplied by OMIM, Nov 2010] |
| Molecular Mass : | 34.76 kDa |
| AA Sequence : | MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGYHSTISN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SPTSSB serine palmitoyltransferase small subunit B [ Homo sapiens (human) ] |
| Official Symbol | SPTSSB |
| Synonyms | SPTSSB; serine palmitoyltransferase small subunit B; Serine Palmitoyltransferase Small Subunit B; Small Subunit Of Serine Palmitoyltransferase B; Androgen Down Regulated In Mouse Prostate; C3orf57; SSSPTB; ADMP; Likely Ortholog Of Androgen Down Regulated Gene Expressed In Mouse Prostate; Serine Palmitoyltransferase, Small Subunit B; Chromosome 3 Open Reading Frame 57; Protein ADMP; serine palmitoyltransferase small subunit B; androgen down regulated in mouse prostate; likely ortholog of androgen down regulated gene expressed in mouse prostate; small subunit of serine palmitoyltransferase B |
| Gene ID | 165679 |
| mRNA Refseq | NM_001040100 |
| Protein Refseq | NP_001035189 |
| MIM | 610412 |
| UniProt ID | Q8NFR3 |
| ◆ Recombinant Proteins | ||
| SPTSSB-8523Z | Recombinant Zebrafish SPTSSB | +Inquiry |
| RFL32123DF | Recombinant Full Length Danio Rerio Serine Palmitoyltransferase Small Subunit B(Sptssb) Protein, His-Tagged | +Inquiry |
| SPTSSB-7438Z | Recombinant Zebrafish SPTSSB | +Inquiry |
| Sptssb-6118M | Recombinant Mouse Sptssb Protein, Myc/DDK-tagged | +Inquiry |
| SPTSSB-5605C | Recombinant Chicken SPTSSB | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPTSSB-8041HCL | Recombinant Human C3orf57 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPTSSB Products
Required fields are marked with *
My Review for All SPTSSB Products
Required fields are marked with *
