Recombinant Human SRD5A1, GST-tagged

Cat.No. : SRD5A1-85H
Product Overview : Recombinant Human SRD5A1, fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2 (MIM 607306).
Molecular Mass : 54.23 kDa
AA Sequence : MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASES APRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPR FLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFT FCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SRD5A1 steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) [ Homo sapiens (human) ]
Official Symbol SRD5A1
Synonyms SRD5A1; steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1); 3-oxo-5-alpha-steroid 4-dehydrogenase 1; S5AR; SR type 1; 3 oxo 5 alpha steroid 4 dehydrogenase 1; 3 Oxo 5 alpha steroid delta 4 dehydrogenase alpha 1; 3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1,5-alpha reductase; 3-oxo-5-alpha-steroid 4-dehydrogenase 1; 5 alpha reductase; S5A1_HUMAN; S5AR 1; SRD5A 1; Srd5a1; Steroid 5 alpha reductase 1; Steroid 5 alpha reductase alpha polypeptide 1 (3 oxo 5 alpha steroid delta 4 dehydrogenase alpha 1); Steroid 5 alpha reductase alpha polypeptide 1; Steroid 5 alpha reductase type I; Steroid 5-alpha-reductase 1; SR type 1; 5-alpha reductase; steroid 5-alpha-reductase 1; steroid 5-alpha-reductase type I; 3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1; S5AR 1
Gene ID 6715
mRNA Refseq NM_001047
Protein Refseq NP_001038
MIM 184753
UniProt ID P18405
Chromosome Location 5p15
Pathway Metabolism of lipids and lipoproteins; Metabolism of steroid hormones and vitamin D; Steroid hormone biosynthesis
Function 3-oxo-5-alpha-steroid 4-dehydrogenase activity; cholestenone 5-alpha-reductase activity; electron carrier activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRD5A1 Products

Required fields are marked with *

My Review for All SRD5A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon