Recombinant Human SRD5A1, GST-tagged
Cat.No. : | SRD5A1-85H |
Product Overview : | Recombinant Human SRD5A1, fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2 (MIM 607306). |
Molecular Mass : | 54.23 kDa |
AA Sequence : | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASES APRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPR FLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFT FCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SRD5A1 steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) [ Homo sapiens (human) ] |
Official Symbol | SRD5A1 |
Synonyms | SRD5A1; steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1); 3-oxo-5-alpha-steroid 4-dehydrogenase 1; S5AR; SR type 1; 3 oxo 5 alpha steroid 4 dehydrogenase 1; 3 Oxo 5 alpha steroid delta 4 dehydrogenase alpha 1; 3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1,5-alpha reductase; 3-oxo-5-alpha-steroid 4-dehydrogenase 1; 5 alpha reductase; S5A1_HUMAN; S5AR 1; SRD5A 1; Srd5a1; Steroid 5 alpha reductase 1; Steroid 5 alpha reductase alpha polypeptide 1 (3 oxo 5 alpha steroid delta 4 dehydrogenase alpha 1); Steroid 5 alpha reductase alpha polypeptide 1; Steroid 5 alpha reductase type I; Steroid 5-alpha-reductase 1; SR type 1; 5-alpha reductase; steroid 5-alpha-reductase 1; steroid 5-alpha-reductase type I; 3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1; S5AR 1 |
Gene ID | 6715 |
mRNA Refseq | NM_001047 |
Protein Refseq | NP_001038 |
MIM | 184753 |
UniProt ID | P18405 |
Chromosome Location | 5p15 |
Pathway | Metabolism of lipids and lipoproteins; Metabolism of steroid hormones and vitamin D; Steroid hormone biosynthesis |
Function | 3-oxo-5-alpha-steroid 4-dehydrogenase activity; cholestenone 5-alpha-reductase activity; electron carrier activity |
◆ Cell & Tissue Lysates | ||
SRD5A1-1690HCL | Recombinant Human SRD5A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRD5A1 Products
Required fields are marked with *
My Review for All SRD5A1 Products
Required fields are marked with *