Recombinant Human SRD5A1 protein, His-tagged
| Cat.No. : | SRD5A1-2624H |
| Product Overview : | Recombinant Human SRD5A1 protein(1-163 aa), fused to His tag, was expressed in E. coli. |
| Availability | October 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-163 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGML |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SRD5A1 steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) [ Homo sapiens ] |
| Official Symbol | SRD5A1 |
| Synonyms | SRD5A1; steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1); 3-oxo-5-alpha-steroid 4-dehydrogenase 1; SR type 1; 5-alpha reductase; steroid 5-alpha-reductase 1; steroid 5-alpha-reductase type I; 3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1; S5AR 1; |
| Gene ID | 6715 |
| mRNA Refseq | NM_001047 |
| Protein Refseq | NP_001038 |
| MIM | 184753 |
| UniProt ID | P18405 |
| ◆ Recombinant Proteins | ||
| SRD5A1-973C | Recombinant Cynomolgus SRD5A1 Protein, His-tagged | +Inquiry |
| SRD5A1-5393R | Recombinant Rat SRD5A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Srd5a1-2099M | Recombinant Mouse Srd5a1 Protein, His-tagged | +Inquiry |
| SRD5A1-5734R | Recombinant Rat SRD5A1 Protein | +Inquiry |
| SRD5A1-15970M | Recombinant Mouse SRD5A1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SRD5A1-1690HCL | Recombinant Human SRD5A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRD5A1 Products
Required fields are marked with *
My Review for All SRD5A1 Products
Required fields are marked with *
