Recombinant Human SRD5A1 protein, His-tagged
Cat.No. : | SRD5A1-2624H |
Product Overview : | Recombinant Human SRD5A1 protein(1-163 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-163 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGML |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SRD5A1 steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) [ Homo sapiens ] |
Official Symbol | SRD5A1 |
Synonyms | SRD5A1; steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1); 3-oxo-5-alpha-steroid 4-dehydrogenase 1; SR type 1; 5-alpha reductase; steroid 5-alpha-reductase 1; steroid 5-alpha-reductase type I; 3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1; S5AR 1; |
Gene ID | 6715 |
mRNA Refseq | NM_001047 |
Protein Refseq | NP_001038 |
MIM | 184753 |
UniProt ID | P18405 |
◆ Recombinant Proteins | ||
SRD5A1-973C | Recombinant Cynomolgus SRD5A1 Protein, His-tagged | +Inquiry |
RFL399MF | Recombinant Full Length Macaca Fascicularis 3-Oxo-5-Alpha-Steroid 4-Dehydrogenase 1(Srd5A1) Protein, His-Tagged | +Inquiry |
SRD5A1-495HF | Recombinant Full Length Human SRD5A1 Protein, GST-tagged | +Inquiry |
SRD5A1-15970M | Recombinant Mouse SRD5A1 Protein | +Inquiry |
SRD5A1-5734R | Recombinant Rat SRD5A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRD5A1-1690HCL | Recombinant Human SRD5A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRD5A1 Products
Required fields are marked with *
My Review for All SRD5A1 Products
Required fields are marked with *
0
Inquiry Basket