Recombinant Human SRD5A2 protein(29-71aa), His-KSI-tagged

Cat.No. : SRD5A2-2197H
Product Overview : Recombinant Human SRD5A2 protein(P31213)(29-71aa), fused with N-terminal His and KSI tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&KSI
Protein Length : 29-71aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 20.0 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : KPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQ
Gene Name SRD5A2 steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) [ Homo sapiens ]
Official Symbol SRD5A2
Synonyms SRD5A2; steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2); 3-oxo-5-alpha-steroid 4-dehydrogenase 2; S5AR 2; SR type 2; 5 alpha-SR2; type II 5-alpha reductase; steroid 5-alpha-reductase 2; 3-oxo-5 alpha-steroid 4-dehydrogenase 2; MGC138457;
Gene ID 6716
mRNA Refseq NM_000348
Protein Refseq NP_000339
UniProt ID P31213

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRD5A2 Products

Required fields are marked with *

My Review for All SRD5A2 Products

Required fields are marked with *

0
cart-icon
0
compare icon