Recombinant Human SRD5A2 protein(29-71aa), His-KSI-tagged

• Cat.No.: SRD5A2-2197H
• Product Overview: Recombinant Human SRD5A2 protein(P31213)(29-71aa), fused with N-terminal His and KSI tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&KSI
• Protein Length: 29-71aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.0 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: KPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQ

Gene Information

• Gene Name: SRD5A2 steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) [ Homo sapiens ]
• Official Symbol: SRD5A2
• Synonyms: SRD5A2; steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2); 3-oxo-5-alpha-steroid 4-dehydrogenase 2; S5AR 2; SR type 2; 5 alpha-SR2; type II 5-alpha reductase; steroid 5-alpha-reductase 2; 3-oxo-5 alpha-steroid 4-dehydrogenase 2; MGC138457
• Gene ID: 6716
• mRNA Refseq: NM_000348
• Protein Refseq: NP_000339
• UniProt ID: P31213