Recombinant Human SREBF1 protein, His-tagged
Cat.No. : | SREBF1-2397H |
Product Overview : | Recombinant Human SREBF1 protein(P36956)(1-490aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-490aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 54.5 kDa |
AA Sequence : | MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SREBF1 sterol regulatory element binding transcription factor 1 [ Homo sapiens ] |
Official Symbol | SREBF1 |
Synonyms | SREBF1; sterol regulatory element binding transcription factor 1; sterol regulatory element-binding protein 1; bHLHd1; SREBP 1c; SREBP1; SREBP-1; class D basic helix-loop-helix protein 1; SREBP-1c; |
Gene ID | 6720 |
mRNA Refseq | NM_001005291 |
Protein Refseq | NP_001005291 |
MIM | 184756 |
UniProt ID | P36956 |
◆ Recombinant Proteins | ||
SREBF1-6354H | Recombinant Human SREBF1 Protein (Met1-Leu466), N-His tagged | +Inquiry |
SREBF1-5997Z | Recombinant Zebrafish SREBF1 | +Inquiry |
Srebf1-8124M | Recombinant Mouse Srebf1 protein, His-tagged | +Inquiry |
SREBF1-2715H | Recombinant Human SREBF1 Protein (1-490 aa), His-tagged | +Inquiry |
SREBF1-2732H | Recombinant Human SREBF1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SREBF1 Products
Required fields are marked with *
My Review for All SREBF1 Products
Required fields are marked with *