Recombinant Human SREBF1 protein, His-tagged
| Cat.No. : | SREBF1-3409H |
| Product Overview : | Recombinant Human SREBF1 protein(1-332 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 30, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-332 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MDEPPFSEAALEQALGEPCDLDAALLTDIEGEVGAGRGRANGLDAPRAGADRGAMDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SREBF1 sterol regulatory element binding transcription factor 1 [ Homo sapiens ] |
| Official Symbol | SREBF1 |
| Synonyms | SREBF1; sterol regulatory element binding transcription factor 1; sterol regulatory element-binding protein 1; bHLHd1; SREBP 1c; SREBP1; SREBP-1; class D basic helix-loop-helix protein 1; SREBP-1c; |
| Gene ID | 6720 |
| mRNA Refseq | NM_001005291 |
| Protein Refseq | NP_001005291 |
| MIM | 184756 |
| UniProt ID | P36956 |
| ◆ Recombinant Proteins | ||
| RFL14072CF | Recombinant Full Length Cricetulus Griseus Sterol Regulatory Element-Binding Protein 1(Srebf1) Protein, His-Tagged | +Inquiry |
| SREBF1-8709M | Recombinant Mouse SREBF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SREBF1-15973M | Recombinant Mouse SREBF1 Protein | +Inquiry |
| SREBF1-2397H | Recombinant Human SREBF1 protein, His-tagged | +Inquiry |
| SREBF1-2715H | Recombinant Human SREBF1 Protein (1-490 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SREBF1 Products
Required fields are marked with *
My Review for All SREBF1 Products
Required fields are marked with *
