Recombinant Human SRGN protein(81-150 aa), C-His-tagged

Cat.No. : SRGN-2624H
Product Overview : Recombinant Human SRGN protein(P10124)(81-150 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 81-150 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : QDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQH
Gene Name SRGN serglycin [ Homo sapiens ]
Official Symbol SRGN
Synonyms SRGN; serglycin; PRG, PRG1, proteoglycan 1, secretory granule; PPG; serglycin proteoglycan; p.PG; proteoglycan 1, secretory granule; platelet proteoglycan core protein; hematopoetic proteoglycan core peptide; hematopoetic proteoglycan core protein; secretory granule proteoglycan core peptide; secretory granule proteoglycan core protein; proteoglycan protein core for mast cell secretory granule; PRG; PRG1; MGC9289; FLJ12930;
Gene ID 5552
mRNA Refseq NM_002727
Protein Refseq NP_002718
MIM 177040
UniProt ID P10124

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRGN Products

Required fields are marked with *

My Review for All SRGN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon