Recombinant Human SRGN protein(81-150 aa), C-His-tagged
| Cat.No. : | SRGN-2624H |
| Product Overview : | Recombinant Human SRGN protein(P10124)(81-150 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 81-150 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | QDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQH |
| Gene Name | SRGN serglycin [ Homo sapiens ] |
| Official Symbol | SRGN |
| Synonyms | SRGN; serglycin; PRG, PRG1, proteoglycan 1, secretory granule; PPG; serglycin proteoglycan; p.PG; proteoglycan 1, secretory granule; platelet proteoglycan core protein; hematopoetic proteoglycan core peptide; hematopoetic proteoglycan core protein; secretory granule proteoglycan core peptide; secretory granule proteoglycan core protein; proteoglycan protein core for mast cell secretory granule; PRG; PRG1; MGC9289; FLJ12930; |
| Gene ID | 5552 |
| mRNA Refseq | NM_002727 |
| Protein Refseq | NP_002718 |
| MIM | 177040 |
| UniProt ID | P10124 |
| ◆ Recombinant Proteins | ||
| SRGN-5400R | Recombinant Rat SRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
| SRGN-2369H | Recombinant Human SRGN protein(Met1-Leu158), His&Myc-tagged | +Inquiry |
| Srgn-2104R | Recombinant Rat Srgn Protein, His&GST-tagged | +Inquiry |
| SRGN-513H | Recombinant Human SRGN, His tagged | +Inquiry |
| SRGN-31397TH | Recombinant Human SRGN | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SRGN-1119HCL | Recombinant Human SRGN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRGN Products
Required fields are marked with *
My Review for All SRGN Products
Required fields are marked with *
