Recombinant Human SRGN protein(81-150 aa), C-His-tagged
Cat.No. : | SRGN-2624H |
Product Overview : | Recombinant Human SRGN protein(P10124)(81-150 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 81-150 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | QDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQH |
Gene Name | SRGN serglycin [ Homo sapiens ] |
Official Symbol | SRGN |
Synonyms | SRGN; serglycin; PRG, PRG1, proteoglycan 1, secretory granule; PPG; serglycin proteoglycan; p.PG; proteoglycan 1, secretory granule; platelet proteoglycan core protein; hematopoetic proteoglycan core peptide; hematopoetic proteoglycan core protein; secretory granule proteoglycan core peptide; secretory granule proteoglycan core protein; proteoglycan protein core for mast cell secretory granule; PRG; PRG1; MGC9289; FLJ12930; |
Gene ID | 5552 |
mRNA Refseq | NM_002727 |
Protein Refseq | NP_002718 |
MIM | 177040 |
UniProt ID | P10124 |
◆ Recombinant Proteins | ||
SRGN-31396TH | Recombinant Human SRGN, His-tagged | +Inquiry |
Srgn-2104R | Recombinant Rat Srgn Protein, His&GST-tagged | +Inquiry |
SRGN-2624H | Recombinant Human SRGN protein(81-150 aa), C-His-tagged | +Inquiry |
SRGN-6884H | Recombinant Human Serglycin, His-tagged | +Inquiry |
SRGN-15982M | Recombinant Mouse SRGN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRGN-1119HCL | Recombinant Human SRGN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SRGN Products
Required fields are marked with *
My Review for All SRGN Products
Required fields are marked with *
0
Inquiry Basket