Recombinant Human SRI protein, GST-tagged
Cat.No. : | SRI-3527H |
Product Overview : | Recombinant Human SRI protein(P30626)(1-198aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-198aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.7 kDa |
AA Sequence : | MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SRI sorcin [ Homo sapiens ] |
Official Symbol | SRI |
Synonyms | SRI; sorcin; H_RG167B05.1; 22 kDa protein; calcium binding protein amplified in mutlidrug-resistant cells; SCN; V19; CP22; CP-22; FLJ26259; |
Gene ID | 6717 |
mRNA Refseq | NM_001256891 |
Protein Refseq | NP_001243820 |
MIM | 182520 |
UniProt ID | P30626 |
◆ Recombinant Proteins | ||
SRI-3478H | Recombinant Human SRI, His-tagged | +Inquiry |
SRI-15983M | Recombinant Mouse SRI Protein | +Inquiry |
SRI-2953H | Recombinant Human SRI, His-tagged | +Inquiry |
SRI-975C | Recombinant Cynomolgus SRI Protein, His-tagged | +Inquiry |
SRI-10691Z | Recombinant Zebrafish SRI | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRI-001HCL | Recombinant Human SRI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRI Products
Required fields are marked with *
My Review for All SRI Products
Required fields are marked with *
0
Inquiry Basket