Recombinant Human SRI Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SRI-1882H |
Product Overview : | SRI MS Standard C13 and N15-labeled recombinant protein (NP_003121) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a calcium-binding protein with multiple E-F hand domains that relocates from the cytoplasm to the sarcoplasmic reticulum in response to elevated calcium levels. In addition to regulating intracellular calcium homeostasis it also modulates excitation-contraction coupling in the heart. Alternative splicing results in multiple transcript variants encoding distinct proteins. Multiple pseudogenes exist for this gene. |
Molecular Mass : | 21.7 kDa |
AA Sequence : | MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SRI sorcin [ Homo sapiens (human) ] |
Official Symbol | SRI |
Synonyms | SRI; sorcin; H_RG167B05.1; 22 kDa protein; calcium binding protein amplified in mutlidrug-resistant cells; SCN; V19; CP22; CP-22; FLJ26259; |
Gene ID | 6717 |
mRNA Refseq | NM_003130 |
Protein Refseq | NP_003121 |
MIM | 182520 |
UniProt ID | P30626 |
◆ Cell & Tissue Lysates | ||
SRI-001HCL | Recombinant Human SRI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SRI Products
Required fields are marked with *
My Review for All SRI Products
Required fields are marked with *
0
Inquiry Basket