Recombinant Human SRR protein, His-SUMO-tagged
| Cat.No. : | SRR-3530H |
| Product Overview : | Recombinant Human SRR protein(Q9GZT4)(1-340aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-340aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 52.6 kDa |
| AA Sequence : | MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | SRR serine racemase [ Homo sapiens ] |
| Official Symbol | SRR |
| Synonyms | SRR; serine racemase; ILV1; ISO1; D-serine dehydratase; L-serine dehydratase; D-serine ammonia-lyase; L-serine ammonia-lyase; |
| Gene ID | 63826 |
| mRNA Refseq | NM_021947 |
| Protein Refseq | NP_068766 |
| MIM | 606477 |
| UniProt ID | Q9GZT4 |
| ◆ Recombinant Proteins | ||
| SRR-2466H | Recombinant Human SRR protein, His-tagged | +Inquiry |
| SRR-3254H | Recombinant Human SRR protein, His-GST-tagged | +Inquiry |
| SRR-2961H | Recombinant Human SRR, GST-tagged | +Inquiry |
| SRR-8728M | Recombinant Mouse SRR Protein, His (Fc)-Avi-tagged | +Inquiry |
| SRR-1114HFL | Active Recombinant Full Length Human SRR Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SRR-1470HCL | Recombinant Human SRR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRR Products
Required fields are marked with *
My Review for All SRR Products
Required fields are marked with *
