Recombinant Human SRR protein, His-SUMO-tagged
Cat.No. : | SRR-3530H |
Product Overview : | Recombinant Human SRR protein(Q9GZT4)(1-340aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-340aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.6 kDa |
AA Sequence : | MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SRR serine racemase [ Homo sapiens ] |
Official Symbol | SRR |
Synonyms | SRR; serine racemase; ILV1; ISO1; D-serine dehydratase; L-serine dehydratase; D-serine ammonia-lyase; L-serine ammonia-lyase; |
Gene ID | 63826 |
mRNA Refseq | NM_021947 |
Protein Refseq | NP_068766 |
MIM | 606477 |
UniProt ID | Q9GZT4 |
◆ Recombinant Proteins | ||
SRR-2961H | Recombinant Human SRR, GST-tagged | +Inquiry |
SRR-5746R | Recombinant Rat SRR Protein | +Inquiry |
SRR-2466H | Recombinant Human SRR protein, His-tagged | +Inquiry |
SRR-1575H | Recombinant Human Serine Racemase, His-tagged | +Inquiry |
SRR-3530H | Recombinant Human SRR protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRR-1470HCL | Recombinant Human SRR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRR Products
Required fields are marked with *
My Review for All SRR Products
Required fields are marked with *