Recombinant Human SRR Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SRR-5706H |
Product Overview : | SRR MS Standard C13 and N15-labeled recombinant protein (NP_068766) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Catalyzes the synthesis of D-serine from L-serine. D-serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine. |
Molecular Mass : | 36.6 kDa |
AA Sequence : | MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SRR serine racemase [ Homo sapiens (human) ] |
Official Symbol | SRR |
Synonyms | SRR; serine racemase; ILV1; ISO1; D-serine dehydratase; L-serine dehydratase; D-serine ammonia-lyase; L-serine ammonia-lyase; |
Gene ID | 63826 |
mRNA Refseq | NM_021947 |
Protein Refseq | NP_068766 |
MIM | 606477 |
UniProt ID | Q9GZT4 |
◆ Recombinant Proteins | ||
SRR-2466H | Recombinant Human SRR protein, His-tagged | +Inquiry |
SRR-8728M | Recombinant Mouse SRR Protein, His (Fc)-Avi-tagged | +Inquiry |
SRR-1114HFL | Active Recombinant Full Length Human SRR Protein, C-Flag-tagged | +Inquiry |
SRR-5405R | Recombinant Rat SRR Protein, His (Fc)-Avi-tagged | +Inquiry |
SRR-2102H | Recombinant Human SRR Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRR-1470HCL | Recombinant Human SRR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRR Products
Required fields are marked with *
My Review for All SRR Products
Required fields are marked with *