Recombinant Human SRR Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SRR-5706H |
| Product Overview : | SRR MS Standard C13 and N15-labeled recombinant protein (NP_068766) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Catalyzes the synthesis of D-serine from L-serine. D-serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine. |
| Molecular Mass : | 36.6 kDa |
| AA Sequence : | MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SRR serine racemase [ Homo sapiens (human) ] |
| Official Symbol | SRR |
| Synonyms | SRR; serine racemase; ILV1; ISO1; D-serine dehydratase; L-serine dehydratase; D-serine ammonia-lyase; L-serine ammonia-lyase; |
| Gene ID | 63826 |
| mRNA Refseq | NM_021947 |
| Protein Refseq | NP_068766 |
| MIM | 606477 |
| UniProt ID | Q9GZT4 |
| ◆ Recombinant Proteins | ||
| SRR-2466H | Recombinant Human SRR protein, His-tagged | +Inquiry |
| SRR-31354TH | Recombinant Human SRR, His-tagged | +Inquiry |
| SRR-2961H | Recombinant Human SRR, GST-tagged | +Inquiry |
| SRR-3254H | Recombinant Human SRR protein, His-GST-tagged | +Inquiry |
| SRR-5706H | Recombinant Human SRR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SRR-1470HCL | Recombinant Human SRR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRR Products
Required fields are marked with *
My Review for All SRR Products
Required fields are marked with *
