Recombinant Human SRSF10 Protein (1-183 aa), His-SUMO-tagged
| Cat.No. : | SRSF10-990H |
| Product Overview : | Recombinant Human SRSF10 Protein (1-183 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Isoform 3. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-183 aa |
| Description : | Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing. Ses to interfere with the U1 snRNP 5'-splice recognition of SNRNP70. Required for splicing repression in M-phase cells and after heat shock. May be involved in regulation of alternative splicing in neurons, with isoform 1 acting as a positive and isoform 3 as a negative regulator. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 38.2 kDa |
| AA Sequence : | MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | SRSF10 serine/arginine-rich splicing factor 10 [ Homo sapiens ] |
| Official Symbol | SRSF10 |
| Synonyms | SRSF10; NSSR; SFRS13; SRp38; SRrp40; TASR1; TASR2; TASR; FUSIP1; FUSIP2; SFRS13A; FLJ30749; FLJ43846; DKFZp686H0644; |
| Gene ID | 10772 |
| mRNA Refseq | NM_001191005 |
| Protein Refseq | NP_001177934 |
| MIM | 605221 |
| UniProt ID | O75494 |
| ◆ Recombinant Proteins | ||
| SRSF10-4474R | Recombinant Rhesus monkey SRSF10 Protein, His-tagged | +Inquiry |
| SRSF10-16009M | Recombinant Mouse SRSF10 Protein | +Inquiry |
| SRSF10-4290R | Recombinant Rhesus Macaque SRSF10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Srsf10-1021M | Recombinant Mouse Srsf10 Protein, MYC/DDK-tagged | +Inquiry |
| SRSF10-2595C | Recombinant Chicken SRSF10 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SRSF10-1906HCL | Recombinant Human SFRS13A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRSF10 Products
Required fields are marked with *
My Review for All SRSF10 Products
Required fields are marked with *
