Recombinant Human SRSF10 Protein (1-183 aa), His-SUMO-tagged
Cat.No. : | SRSF10-990H |
Product Overview : | Recombinant Human SRSF10 Protein (1-183 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Isoform 3. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-183 aa |
Description : | Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing. Ses to interfere with the U1 snRNP 5'-splice recognition of SNRNP70. Required for splicing repression in M-phase cells and after heat shock. May be involved in regulation of alternative splicing in neurons, with isoform 1 acting as a positive and isoform 3 as a negative regulator. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 38.2 kDa |
AA Sequence : | MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | SRSF10 serine/arginine-rich splicing factor 10 [ Homo sapiens ] |
Official Symbol | SRSF10 |
Synonyms | SRSF10; NSSR; SFRS13; SRp38; SRrp40; TASR1; TASR2; TASR; FUSIP1; FUSIP2; SFRS13A; FLJ30749; FLJ43846; DKFZp686H0644; |
Gene ID | 10772 |
mRNA Refseq | NM_001191005 |
Protein Refseq | NP_001177934 |
MIM | 605221 |
UniProt ID | O75494 |
◆ Recombinant Proteins | ||
SRSF10-8735M | Recombinant Mouse SRSF10 Protein, His (Fc)-Avi-tagged | +Inquiry |
SRSF10-3170H | Recombinant Human SRSF10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SRSF10-16009M | Recombinant Mouse SRSF10 Protein | +Inquiry |
Srsf10-1021M | Recombinant Mouse Srsf10 Protein, MYC/DDK-tagged | +Inquiry |
SRSF10-2595C | Recombinant Chicken SRSF10 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRSF10-1906HCL | Recombinant Human SFRS13A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRSF10 Products
Required fields are marked with *
My Review for All SRSF10 Products
Required fields are marked with *
0
Inquiry Basket