Recombinant Human SRSF3
Cat.No. : | SRSF3-26855TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1-85 of Human SFRS3 with an N terminal proprietary tag; Predicted MWt 34.98 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 85 amino acids |
Description : | The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants, one protein-coding and the other non-coding, have been found for this gene. |
Molecular Weight : | 34.980kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEK |
Sequence Similarities : | Belongs to the splicing factor SR family.Contains 1 RRM (RNA recognition motif) domain. |
Gene Name | SRSF3 serine/arginine-rich splicing factor 3 [ Homo sapiens ] |
Official Symbol | SRSF3 |
Synonyms | SRSF3; serine/arginine-rich splicing factor 3; SFRS3, splicing factor, arginine/serine rich 3; SRp20; |
Gene ID | 6428 |
mRNA Refseq | NM_003017 |
Protein Refseq | NP_003008 |
MIM | 603364 |
Uniprot ID | P84103 |
Chromosome Location | 6p21 |
Pathway | Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; |
Function | RNA binding; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
SRSF3-26855TH | Recombinant Human SRSF3 | +Inquiry |
SRSF3-26854TH | Recombinant Human SRSF3 | +Inquiry |
SRSF3-497HF | Recombinant Full Length Human SRSF3 Protein | +Inquiry |
SRSF3-4573H | Recombinant Human SRSF3 protein, His-GB1-tagged | +Inquiry |
SRSF3-4142C | Recombinant Chicken SRSF3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRSF3-1904HCL | Recombinant Human SFRS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRSF3 Products
Required fields are marked with *
My Review for All SRSF3 Products
Required fields are marked with *