Recombinant Human SRSF3 protein, His-GB1-tagged

Cat.No. : SRSF3-4573H
Product Overview : Recombinant Human SRSF3 protein(P84103)(1-86aa), fused to N-terminal His tag and GB1 tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GB1&His
Protein Length : 1-86aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 17.9 kDa
AA Sequence : MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name SRSF3 serine/arginine-rich splicing factor 3 [ Homo sapiens ]
Official Symbol SRSF3
Synonyms SRSF3; serine/arginine-rich splicing factor 3; SFRS3, splicing factor, arginine/serine rich 3; SRp20; pre-mRNA-splicing factor SRP20; splicing factor, arginine/serine-rich 3; splicing factor, arginine/serine-rich, 20-kD; SFRS3;
Gene ID 6428
mRNA Refseq NM_003017
Protein Refseq NP_003008
MIM 603364
UniProt ID P84103

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRSF3 Products

Required fields are marked with *

My Review for All SRSF3 Products

Required fields are marked with *

0
cart-icon