Recombinant Human SRSF3 protein, His-GB1-tagged

• Cat.No.: SRSF3-4573H
• Product Overview: Recombinant Human SRSF3 protein(P84103)(1-86aa), fused to N-terminal His tag and GB1 tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GB1&His
• Protein Length: 1-86aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 17.9 kDa
• AA Sequence: MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: SRSF3 serine/arginine-rich splicing factor 3 [ Homo sapiens ]
• Official Symbol: SRSF3
• Synonyms: SRSF3; serine/arginine-rich splicing factor 3; SFRS3, splicing factor, arginine/serine rich 3; SRp20; pre-mRNA-splicing factor SRP20; splicing factor, arginine/serine-rich 3; splicing factor, arginine/serine-rich, 20-kD; SFRS3
• Gene ID: 6428
• mRNA Refseq: NM_003017
• Protein Refseq: NP_003008
• MIM: 603364
• UniProt ID: P84103