Recombinant Human SRSF3 protein, His-GB1-tagged
Cat.No. : | SRSF3-4573H |
Product Overview : | Recombinant Human SRSF3 protein(P84103)(1-86aa), fused to N-terminal His tag and GB1 tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GB1&His |
Protein Length : | 1-86aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.9 kDa |
AA Sequence : | MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | SRSF3 serine/arginine-rich splicing factor 3 [ Homo sapiens ] |
Official Symbol | SRSF3 |
Synonyms | SRSF3; serine/arginine-rich splicing factor 3; SFRS3, splicing factor, arginine/serine rich 3; SRp20; pre-mRNA-splicing factor SRP20; splicing factor, arginine/serine-rich 3; splicing factor, arginine/serine-rich, 20-kD; SFRS3; |
Gene ID | 6428 |
mRNA Refseq | NM_003017 |
Protein Refseq | NP_003008 |
MIM | 603364 |
UniProt ID | P84103 |
◆ Recombinant Proteins | ||
SRSF3-26855TH | Recombinant Human SRSF3 | +Inquiry |
SRSF3-26854TH | Recombinant Human SRSF3 | +Inquiry |
SRSF3-4573H | Recombinant Human SRSF3 protein, His-GB1-tagged | +Inquiry |
SRSF3-4142C | Recombinant Chicken SRSF3 | +Inquiry |
SRSF3-497HF | Recombinant Full Length Human SRSF3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRSF3-1904HCL | Recombinant Human SFRS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRSF3 Products
Required fields are marked with *
My Review for All SRSF3 Products
Required fields are marked with *