Recombinant Human SRSF4
| Cat.No. : | SRSF4-26856TH |
| Product Overview : | Recombinant fragment of Human SFRS4 with N-terminal proprietary tag. Predicted MW 34.10 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 77 amino acids |
| Description : | This gene encodes a member of the arginine/serine-rich splicing factor family. The encoded protein likely functions in mRNA processing. |
| Molecular Weight : | 34.100kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | PPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVE |
| Sequence Similarities : | Belongs to the splicing factor SR family.Contains 2 RRM (RNA recognition motif) domains. |
| Gene Name | SRSF4 serine/arginine-rich splicing factor 4 [ Homo sapiens ] |
| Official Symbol | SRSF4 |
| Synonyms | SRSF4; serine/arginine-rich splicing factor 4; SFRS4, splicing factor, arginine/serine rich 4; SR splicing factor 4; SRP75; |
| Gene ID | 6429 |
| mRNA Refseq | NM_005626 |
| Protein Refseq | NP_005617 |
| MIM | 601940 |
| Uniprot ID | Q08170 |
| Chromosome Location | 1p35.3 |
| Pathway | Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; |
| Function | RNA binding; nucleotide binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRSF4 Products
Required fields are marked with *
My Review for All SRSF4 Products
Required fields are marked with *



