Recombinant Human SRSF4
Cat.No. : | SRSF4-26856TH |
Product Overview : | Recombinant fragment of Human SFRS4 with N-terminal proprietary tag. Predicted MW 34.10 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 77 amino acids |
Description : | This gene encodes a member of the arginine/serine-rich splicing factor family. The encoded protein likely functions in mRNA processing. |
Molecular Weight : | 34.100kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVE |
Sequence Similarities : | Belongs to the splicing factor SR family.Contains 2 RRM (RNA recognition motif) domains. |
Gene Name | SRSF4 serine/arginine-rich splicing factor 4 [ Homo sapiens ] |
Official Symbol | SRSF4 |
Synonyms | SRSF4; serine/arginine-rich splicing factor 4; SFRS4, splicing factor, arginine/serine rich 4; SR splicing factor 4; SRP75; |
Gene ID | 6429 |
mRNA Refseq | NM_005626 |
Protein Refseq | NP_005617 |
MIM | 601940 |
Uniprot ID | Q08170 |
Chromosome Location | 1p35.3 |
Pathway | Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; |
Function | RNA binding; nucleotide binding; |
◆ Recombinant Proteins | ||
SRSF4-4476R | Recombinant Rhesus monkey SRSF4 Protein, His-tagged | +Inquiry |
SRSF4-9977Z | Recombinant Zebrafish SRSF4 | +Inquiry |
SRSF4-26856TH | Recombinant Human SRSF4 | +Inquiry |
SRSF4-4292R | Recombinant Rhesus Macaque SRSF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRSF4-588HCL | Recombinant Human SRSF4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRSF4 Products
Required fields are marked with *
My Review for All SRSF4 Products
Required fields are marked with *
0
Inquiry Basket