Recombinant Human SSBP1 protein, His-tagged
Cat.No. : | SSBP1-2966H |
Product Overview : | Recombinant Human SSBP1 protein(1-148 aa), fused with N-terminal His Tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-148 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE |
Gene Name | SSBP1 single-stranded DNA binding protein 1 [ Homo sapiens ] |
Official Symbol | SSBP1 |
Synonyms | SSBP1; single-stranded DNA binding protein 1; single stranded DNA binding protein; single-stranded DNA-binding protein, mitochondrial; SSBP; PWP1-interacting protein 17; mtSSB; Mt-SSB; SOSS-B1; |
Gene ID | 6742 |
mRNA Refseq | NM_001256510 |
Protein Refseq | NP_001243439 |
MIM | 600439 |
UniProt ID | Q04837 |
◆ Recombinant Proteins | ||
SSBP1-2966H | Recombinant Human SSBP1 protein, His-tagged | +Inquiry |
SSBP1-5411R | Recombinant Rat SSBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SSBP1-5752R | Recombinant Rat SSBP1 Protein | +Inquiry |
SSBP1-4482R | Recombinant Rhesus monkey SSBP1 Protein, His-tagged | +Inquiry |
SSBP1-2965H | Recombinant Human SSBP1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSBP1-1465HCL | Recombinant Human SSBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SSBP1 Products
Required fields are marked with *
My Review for All SSBP1 Products
Required fields are marked with *
0
Inquiry Basket