Recombinant Human SST protein, Myc/DDK-tagged

Cat.No. : SST-01H
Product Overview : Recombinant protein of human somatostatin (SST) was expressed in HEK293T, with a Myc/DDK tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells.
Form : 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Molecular Mass : 10.3 kDa
AA Sequence : MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEP EDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method
Gene Name SST somatostatin [ Homo sapiens (human) ]
Official Symbol SST
Synonyms SMST; SST1
Gene ID 6750
mRNA Refseq NM_001048
Protein Refseq NP_001039
MIM 182450
UniProt ID P61278

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SST Products

Required fields are marked with *

My Review for All SST Products

Required fields are marked with *

0

Inquiry Basket

cartIcon