Recombinant Human SST Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SST-5354H
Product Overview : SST MS Standard C13 and N15-labeled recombinant protein (NP_001039) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells.
Molecular Mass : 12.74 kDa
AA Sequence : MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SST somatostatin [ Homo sapiens (human) ]
Official Symbol SST
Synonyms SST; somatostatin; SMST; somatostatin 14; somatostatin 28; somatostatin-14; somatostatin-28; growth hormone release-inhibiting factor;
Gene ID 6750
mRNA Refseq NM_001048
Protein Refseq NP_001039
MIM 182450
UniProt ID P61278

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SST Products

Required fields are marked with *

My Review for All SST Products

Required fields are marked with *

0

Inquiry Basket

cartIcon