Recombinant Human SST Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SST-5354H |
Product Overview : | SST MS Standard C13 and N15-labeled recombinant protein (NP_001039) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells. |
Molecular Mass : | 12.74 kDa |
AA Sequence : | MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SST somatostatin [ Homo sapiens (human) ] |
Official Symbol | SST |
Synonyms | SST; somatostatin; SMST; somatostatin 14; somatostatin 28; somatostatin-14; somatostatin-28; growth hormone release-inhibiting factor; |
Gene ID | 6750 |
mRNA Refseq | NM_001048 |
Protein Refseq | NP_001039 |
MIM | 182450 |
UniProt ID | P61278 |
◆ Recombinant Proteins | ||
SST-01H | Recombinant Human SST protein, Myc/DDK-tagged | +Inquiry |
SST-4309R | Recombinant Rhesus Macaque SST Protein, His (Fc)-Avi-tagged | +Inquiry |
SST-02 | Synthetic Somatostatin Polypeptide | +Inquiry |
Sst-2619M | Recombinant Mouse Sst protein, His-tagged | +Inquiry |
Sst-6147M | Recombinant Mouse Sst Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SST-1454HCL | Recombinant Human SST 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SST Products
Required fields are marked with *
My Review for All SST Products
Required fields are marked with *
0
Inquiry Basket