Active Recombinant Human SSTR2 full length Transmembrane Protein, His-tagged
Cat.No. : | SSTR2-1021H |
Product Overview : | Active Recombinant Human SSTR2 Protein(P30874)(1-369aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-369aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
Bio-activity : | Human SSTR2 Full Length Protein captured on LifeDiscTM COOH chip (in presence of FOS-12) can bind [Tyr3]Octreotate with an affinity constant of 22.9 μM as detected by MetaSPR Assay (WeSPRTM One). |
Molecular Mass : | 47.4 kDa |
AASequence : | MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
UniProt ID-Weblink : | https://www.uniprot.org/uniprot/ |
◆ Cell & Tissue Lysates | ||
SSTR2-1452HCL | Recombinant Human SSTR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SSTR2 Products
Required fields are marked with *
My Review for All SSTR2 Products
Required fields are marked with *