Recombinant Human SSTR5 protein, His-tagged
Cat.No. : | SSTR5-4519H |
Product Overview : | Recombinant Human SSTR5 protein(P35346)(1-364 aa), fused with C-terminal His tag, was expressed in Mammalian Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | His |
Protein Length : | 1-364 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 40.6 kDa |
AASequence : | MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | SSTR5 somatostatin receptor 5 [ Homo sapiens ] |
Official Symbol | SSTR5 |
Synonyms | SSTR5; somatostatin receptor 5; somatostatin receptor type 5; somatostatin receptor subtype 5; SS-5-R; |
Gene ID | 6755 |
mRNA Refseq | NM_001053 |
Protein Refseq | NP_001044 |
MIM | 182455 |
UniProt ID | P35346 |
◆ Recombinant Proteins | ||
SSTR5-16046M | Recombinant Mouse SSTR5 Protein | +Inquiry |
SSTR5-2204C | Recombinant Chicken SSTR5 | +Inquiry |
SSTR5-4519H | Recombinant Human SSTR5 protein, His-tagged | +Inquiry |
RFL31600RF | Recombinant Full Length Rat Somatostatin Receptor Type 5(Sstr5) Protein, His-Tagged | +Inquiry |
SSTR5-2972H | Recombinant Human SSTR5, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSTR5-1699HCL | Recombinant Human SSTR5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SSTR5 Products
Required fields are marked with *
My Review for All SSTR5 Products
Required fields are marked with *