Recombinant Human SSTR5 protein, His-tagged

• Cat.No.: SSTR5-4519H
• Product Overview: Recombinant Human SSTR5 protein(P35346)(1-364 aa), fused with C-terminal His tag, was expressed in Mammalian Cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: His
• Protein Length: 1-364 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 40.6 kDa
• AASequence: MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: SSTR5 somatostatin receptor 5 [ Homo sapiens ]
• Official Symbol: SSTR5
• Synonyms: SSTR5; somatostatin receptor 5; somatostatin receptor type 5; somatostatin receptor subtype 5; SS-5-R
• Gene ID: 6755
• mRNA Refseq: NM_001053
• Protein Refseq: NP_001044
• MIM: 182455
• UniProt ID: P35346