Recombinant Human SSX2 protein, His/SUMO-tagged
Cat.No. : | SSX2-236H |
Product Overview : | Recombinant Human SSX2(1-188aa) fused with His/SUMO tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-188aa |
Description : | The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are probably responsible for transforming activity. Two transcript variants encoding distinct isoforms have been identified for this gene. |
Molecular Mass : | 37.55kD |
AA Sequence : | MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKASEKIFYVYMKRKYEAMTKLGFKATLPPFMCNKR AEDFQGNDLDNDPNRGNQVERPQMTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTSEK IHERSGPKRGEHAWTHRLPERKQLVIYEEISDPEEDDE |
Gene Name | SSX2 synovial sarcoma, X breakpoint 2 [ Homo sapiens ] |
Official Symbol | SSX2 |
Synonyms | SSX2; synovial sarcoma, X breakpoint 2; SSX; protein SSX2; cancer/testis antigen family 5; member 2a; CT5.2a; HD21; HOM MEL 40; MGC3884; MGC15364; MGC119055; sarcoma; synovial; X chromosome related 2; synovial sarcoma; X breakpoint 2; isoform b; X breakpoint 2B; CT5.2; tumor antigen HOM-MEL-40; cancer/testis antigen 5.2; synovial sarcoma, X breakpoint 2B; cancer/testis antigen family 5, member 2a; sarcoma, synovial, X-chromosome-related 2; synovial sarcoma, X breakpoint 2, isoform b; SSX2B; HOM-MEL-40; |
Gene ID | 6757 |
mRNA Refseq | NM_003147 |
Protein Refseq | NP_003138 |
MIM | 300192 |
UniProt ID | Q16385 |
Chromosome Location | Xp11.22 |
Pathway | Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; |
◆ Recombinant Proteins | ||
SSX2-236H | Recombinant Human SSX2 protein, His/SUMO-tagged | +Inquiry |
SSX2-31172TH | Recombinant Human SSX2 | +Inquiry |
SSX2-503HF | Recombinant Full Length Human SSX2 Protein | +Inquiry |
SSX2-2109H | Recombinant Human SSX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SSX2-301603H | Recombinant Human SSX2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSX2-1448HCL | Recombinant Human SSX2 293 Cell Lysate | +Inquiry |
SSX2-1449HCL | Recombinant Human SSX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SSX2 Products
Required fields are marked with *
My Review for All SSX2 Products
Required fields are marked with *
0
Inquiry Basket