"SSX2" Related Products

Recombinant Human SSX2 protein, His/SUMO-tagged

Cat.No.: SSX2-236H
Product Overview: Recombinant Human SSX2(1-188aa) fused with His/SUMO tag was expressed in E. coli.
Description: The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are probably responsible for transforming activity. Two transcript variants encoding distinct isoforms have been identified for this gene.
Source: E. coli
Species: Human
Tag: His/SUMO
Molecular Mass: 37.55kD
Protein length: 1-188aa
AA Sequence: MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKASEKIFYVYMKRKYEAMTKLGFKATLPPFMCNKR AEDFQGNDLDNDPNRGNQVERPQMTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTSEK IHERSGPKRGEHAWTHRLPERKQLVIYEEISDPEEDDE
Gene Name: SSX2 synovial sarcoma, X breakpoint 2 [ Homo sapiens ]
Official Symbol: SSX2
Synonyms: SSX2; synovial sarcoma, X breakpoint 2; SSX; protein SSX2; cancer/testis antigen family 5; member 2a; CT5.2a; HD21; HOM MEL 40; MGC3884; MGC15364; MGC119055; sarcoma; synovial; X chromosome related 2; synovial sarcoma; X breakpoint 2; isoform b; X breakpoint 2B; CT5.2; tumor antigen HOM-MEL-40; cancer/testis antigen 5.2; synovial sarcoma, X breakpoint 2B; cancer/testis antigen family 5, member 2a; sarcoma, synovial, X-chromosome-related 2; synovial sarcoma, X breakpoint 2, isoform b; SSX2B; HOM-MEL-40;
Gene ID: 6757
mRNA Refseq: NM_003147
Protein Refseq: NP_003138
MIM: 300192
UniProt ID: Q16385
Chromosome Location: Xp11.22
Pathway: Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.