Recombinant Human ST14

Cat.No. : ST14-30315TH
Product Overview : Recombinant fragment corresponding to amino acids 298-400 of Human ST14 with an N terminal proprietary tag; Predicted MWt 36.96 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 103 amino acids
Description : The protein encoded by this gene is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.
Molecular Weight : 36.960kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PPSYNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPRM SSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEVPNNQH VKVRFKFFYLLEPGVPAGTCPKD
Sequence Similarities : Belongs to the peptidase S1 family.Contains 2 CUB domains.Contains 4 LDL-receptor class A domains.Contains 1 peptidase S1 domain.
Gene Name ST14 suppression of tumorigenicity 14 (colon carcinoma) [ Homo sapiens ]
Official Symbol ST14
Synonyms ST14; suppression of tumorigenicity 14 (colon carcinoma); PRSS14; suppressor of tumorigenicity 14 protein; epithin; HAI; matriptase; MT SP1; SNC19; TMPRSS14;
Gene ID 6768
mRNA Refseq NM_021978
Protein Refseq NP_068813
MIM 606797
Uniprot ID Q9Y5Y6
Chromosome Location 11q24-q25
Function peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ST14 Products

Required fields are marked with *

My Review for All ST14 Products

Required fields are marked with *

0
cart-icon