Recombinant Human ST14
| Cat.No. : | ST14-30315TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 298-400 of Human ST14 with an N terminal proprietary tag; Predicted MWt 36.96 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 103 amino acids |
| Description : | The protein encoded by this gene is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis. |
| Molecular Weight : | 36.960kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | PPSYNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPRM SSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEVPNNQH VKVRFKFFYLLEPGVPAGTCPKD |
| Sequence Similarities : | Belongs to the peptidase S1 family.Contains 2 CUB domains.Contains 4 LDL-receptor class A domains.Contains 1 peptidase S1 domain. |
| Gene Name | ST14 suppression of tumorigenicity 14 (colon carcinoma) [ Homo sapiens ] |
| Official Symbol | ST14 |
| Synonyms | ST14; suppression of tumorigenicity 14 (colon carcinoma); PRSS14; suppressor of tumorigenicity 14 protein; epithin; HAI; matriptase; MT SP1; SNC19; TMPRSS14; |
| Gene ID | 6768 |
| mRNA Refseq | NM_021978 |
| Protein Refseq | NP_068813 |
| MIM | 606797 |
| Uniprot ID | Q9Y5Y6 |
| Chromosome Location | 11q24-q25 |
| Function | peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity; |
| ◆ Recombinant Proteins | ||
| ST14-16060M | Recombinant Mouse ST14 Protein | +Inquiry |
| St14-653M | Active Recombinant Mouse St14 Protein, Met & His-tagged | +Inquiry |
| ST14-10H | Active Recombinant Human ST14 Protein, no tag | +Inquiry |
| ST14-30315TH | Recombinant Human ST14 | +Inquiry |
| St14-210M | Active Recombinant Mouse St14, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ST14 Products
Required fields are marked with *
My Review for All ST14 Products
Required fields are marked with *
Recently Viewed
