Recombinant Human STAM binding protein, His tagged
Cat.No. : | STAMBP-7223H |
Product Overview : | Recombinant Human STAMBP Protein with His tag was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-424 aa |
Description : | Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. |
Tag : | N-His |
Molecular Mass : | 51 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose |
Concentration : | 0.85 mg/mL by BCA |
Gene Name | STAMBP STAM binding protein [ Homo sapiens (human) ] |
Official Symbol | STAMBP |
Synonyms | STAMBP; STAM binding protein; STAM-binding protein; AMSH; endosome-associated ubiquitin isopeptidase; associated molecule with the SH3 domain of STAM; MGC126516; MGC126518 |
Gene ID | 10617 |
mRNA Refseq | NM_006463 |
Protein Refseq | NP_006454 |
MIM | 606247 |
UniProt ID | O95630 |
◆ Recombinant Proteins | ||
STAMBP-4507R | Recombinant Rhesus monkey STAMBP Protein, His-tagged | +Inquiry |
STAMBP-671H | Recombinant Human STAMBP Protein, His-tagged | +Inquiry |
STAMBP-1350S | Recombinant Human STAMBP Protein (S2-R424), Tag Free | +Inquiry |
STAMBP-4323R | Recombinant Rhesus Macaque STAMBP Protein, His (Fc)-Avi-tagged | +Inquiry |
STAMBP-5435R | Recombinant Rat STAMBP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAMBP-1428HCL | Recombinant Human STAMBP 293 Cell Lysate | +Inquiry |
STAMBP-1427HCL | Recombinant Human STAMBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STAMBP Products
Required fields are marked with *
My Review for All STAMBP Products
Required fields are marked with *
0
Inquiry Basket