Recombinant Human STAM binding protein, His tagged

Cat.No. : STAMBP-7223H
Product Overview : Recombinant Human STAMBP Protein with His tag was expressed in E. coli.
Availability November 08, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-424 aa
Description : Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.
Tag : N-His
Molecular Mass : 51 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose
Concentration : 0.85 mg/mL by BCA
Gene Name STAMBP STAM binding protein [ Homo sapiens (human) ]
Official Symbol STAMBP
Synonyms STAMBP; STAM binding protein; STAM-binding protein; AMSH; endosome-associated ubiquitin isopeptidase; associated molecule with the SH3 domain of STAM; MGC126516; MGC126518
Gene ID 10617
mRNA Refseq NM_006463
Protein Refseq NP_006454
MIM 606247
UniProt ID O95630

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STAMBP Products

Required fields are marked with *

My Review for All STAMBP Products

Required fields are marked with *

0
cart-icon
0
compare icon