Recombinant Human STAR
Cat.No. : | STAR-30115TH |
Product Overview : | Recombinant full length Human StAR with N terminal proprietary tag, 57.46kDa inclusive of tag. Purified from an in vitro wheat germ expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 286 amino acids |
Description : | The protein encoded by this gene plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. This protein permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13. |
Molecular Weight : | 57.460kDa inclusive of tags |
Tissue specificity : | Expressed in gonads, adrenal cortex and kidney. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLLATFKLCAGSSYRHMRNMKGLRQQAVMAISQELNRRAL GGPTPSTWINQVRRRSSLLGSRLEETLYSDQELAYLQQGE EAMQKALGILSNQEGWKKESQQDNGDKVMSKVVPDVGKVF RLEVVVDQPMERLYEELVERMEAMGEWNPNVKEIKVLQKI GKDTFITHELAAEAAGNLVGPRDFVSVRCAKRRGSTCVLA GMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLT WLLSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPA SEARC |
Sequence Similarities : | Contains 1 START domain. |
Gene Name | STAR steroidogenic acute regulatory protein [ Homo sapiens ] |
Official Symbol | STAR |
Synonyms | STAR; steroidogenic acute regulatory protein; steroidogenic acute regulator; steroidogenic acute regulatory protein, mitochondrial; StAR; StAR related lipid transfer (START) domain containing 1; STARD1; |
Gene ID | 6770 |
mRNA Refseq | NM_000349 |
Protein Refseq | NP_000340 |
MIM | 600617 |
Uniprot ID | P49675 |
Chromosome Location | 8p11.2 |
Pathway | Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Pregnenolone biosynthesis, organism-specific biosystem; |
Function | cholesterol binding; cholesterol transporter activity; lipid binding; |
◆ Recombinant Proteins | ||
STAR-5436R | Recombinant Rat STAR Protein, His (Fc)-Avi-tagged | +Inquiry |
STAR-16098M | Recombinant Mouse STAR Protein | +Inquiry |
STAR-9193Z | Recombinant Zebrafish STAR | +Inquiry |
STAR-4326R | Recombinant Rhesus Macaque STAR Protein, His (Fc)-Avi-tagged | +Inquiry |
STAR-507H | Recombinant Human STAR Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAR-637HCL | Recombinant Human STAR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STAR Products
Required fields are marked with *
My Review for All STAR Products
Required fields are marked with *