Recombinant Human STAR, His-tagged
| Cat.No. : | STAR-30116TH |
| Product Overview : | Recombinant full length Human StAR with an N terminal His tag; 243aa, 27.1kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 222 amino acids |
| Description : | The protein encoded by this gene plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. This protein permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13. |
| Conjugation : | HIS |
| Molecular Weight : | 27.100kDa inclusive of tags |
| Tissue specificity : | Expressed in gonads, adrenal cortex and kidney. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.03% DTT |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEETLYSDQELAYLQQGEEA MQKALGILSNQEGWKKESQQDNGDKVMSKVVPDVGKVFRL EVVVDQPMERLYEELVERMEAMGEWNPNVKEIKVLQKIGK DTFITHELAAEAAGNLVGPRDFVSVRCAKRRGSTCVLAGM ATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLTWL LSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPASE ARC |
| Sequence Similarities : | Contains 1 START domain. |
| Gene Name | STAR steroidogenic acute regulatory protein [ Homo sapiens ] |
| Official Symbol | STAR |
| Synonyms | STAR; steroidogenic acute regulatory protein; steroidogenic acute regulator; steroidogenic acute regulatory protein, mitochondrial; StAR; StAR related lipid transfer (START) domain containing 1; STARD1; |
| Gene ID | 6770 |
| mRNA Refseq | NM_000349 |
| Protein Refseq | NP_000340 |
| MIM | 600617 |
| Uniprot ID | P49675 |
| Chromosome Location | 8p11.2 |
| Pathway | Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Pregnenolone biosynthesis, organism-specific biosystem; |
| Function | cholesterol binding; cholesterol transporter activity; lipid binding; |
| ◆ Recombinant Proteins | ||
| STAR-1292H | Recombinant Human Steroidogenic Acute Regulatory Protein, His-tagged | +Inquiry |
| STAR-1693HFL | Recombinant Full Length Human STAR Protein, C-Flag-tagged | +Inquiry |
| STAR-2113H | Recombinant Human STAR Protein, His (Fc)-Avi-tagged | +Inquiry |
| STAR-8780M | Recombinant Mouse STAR Protein, His (Fc)-Avi-tagged | +Inquiry |
| STAR-5436R | Recombinant Rat STAR Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STAR-637HCL | Recombinant Human STAR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STAR Products
Required fields are marked with *
My Review for All STAR Products
Required fields are marked with *
