Recombinant Human STARD7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | STARD7-4926H |
Product Overview : | STARD7 MS Standard C13 and N15-labeled recombinant protein (NP_644672) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | STARD7 (StAR Related Lipid Transfer Domain Containing 7) is a Protein Coding gene. Diseases associated with STARD7 include Epilepsy, Familial Adult Myoclonic, 2 and Familial Adult Myoclonic Epilepsy. Among its related pathways are Synthesis of PC and Metabolism. Gene Ontology (GO) annotations related to this gene include lipid binding. An important paralog of this gene is PCTP. |
Molecular Mass : | 34.6 kDa |
AA Sequence : | MAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQPWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNEGSCGPARIEYATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | STARD7 StAR related lipid transfer domain containing 7 [ Homo sapiens (human) ] |
Official Symbol | STARD7 |
Synonyms | STARD7; StAR-related lipid transfer (START) domain containing 7; START domain containing 7; stAR-related lipid transfer protein 7, mitochondrial; GTT1; START domain-containing protein 7; gestational trophoblastic tumor protein 1; |
Gene ID | 56910 |
mRNA Refseq | NM_139267 |
Protein Refseq | NP_644672 |
MIM | 616712 |
UniProt ID | Q9NQZ5 |
◆ Recombinant Proteins | ||
STARD7-4515R | Recombinant Rhesus monkey STARD7 Protein, His-tagged | +Inquiry |
Stard7-6167M | Recombinant Mouse Stard7 Protein, Myc/DDK-tagged | +Inquiry |
STARD7-4926H | Recombinant Human STARD7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
STARD7-8784M | Recombinant Mouse STARD7 Protein, His (Fc)-Avi-tagged | +Inquiry |
STARD7-2929H | Recombinant Human STARD7, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STARD7-1420HCL | Recombinant Human STARD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STARD7 Products
Required fields are marked with *
My Review for All STARD7 Products
Required fields are marked with *