Recombinant Human STARD7 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : STARD7-4926H
Product Overview : STARD7 MS Standard C13 and N15-labeled recombinant protein (NP_644672) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : STARD7 (StAR Related Lipid Transfer Domain Containing 7) is a Protein Coding gene. Diseases associated with STARD7 include Epilepsy, Familial Adult Myoclonic, 2 and Familial Adult Myoclonic Epilepsy. Among its related pathways are Synthesis of PC and Metabolism. Gene Ontology (GO) annotations related to this gene include lipid binding. An important paralog of this gene is PCTP.
Molecular Mass : 34.6 kDa
AA Sequence : MAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQPWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNEGSCGPARIEYATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name STARD7 StAR related lipid transfer domain containing 7 [ Homo sapiens (human) ]
Official Symbol STARD7
Synonyms STARD7; StAR-related lipid transfer (START) domain containing 7; START domain containing 7; stAR-related lipid transfer protein 7, mitochondrial; GTT1; START domain-containing protein 7; gestational trophoblastic tumor protein 1;
Gene ID 56910
mRNA Refseq NM_139267
Protein Refseq NP_644672
MIM 616712
UniProt ID Q9NQZ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STARD7 Products

Required fields are marked with *

My Review for All STARD7 Products

Required fields are marked with *

0
cart-icon