Recombinant Human STATH protein, His-SUMO-tagged
Cat.No. : | STATH-3534H |
Product Overview : | Recombinant Human STATH protein(P02808)(20-62aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 20-62aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.7 kDa |
AA Sequence : | DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | STATH statherin [ Homo sapiens ] |
Official Symbol | STATH |
Synonyms | STATH; statherin; STR; |
Gene ID | 6779 |
mRNA Refseq | NM_001009181 |
Protein Refseq | NP_001009181 |
MIM | 184470 |
UniProt ID | P02808 |
◆ Recombinant Proteins | ||
STATH-136H | Recombinant Human STATH, Fc tagged | +Inquiry |
STATH-3214H | Recombinant Human STATH protein(Met1-Phe62), mFc-tagged | +Inquiry |
STATH-481H | Recombinant Human STATH Protein, His/GST-tagged | +Inquiry |
STATH-224H | Recombinant Human STATH Protein, GST-His-tagged | +Inquiry |
STATH-3534H | Recombinant Human STATH protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STATH-785HCL | Recombinant Human STATH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STATH Products
Required fields are marked with *
My Review for All STATH Products
Required fields are marked with *
0
Inquiry Basket