Recombinant Human STBD1 protein, GST-tagged
| Cat.No. : | STBD1-2999H |
| Product Overview : | Recombinant Human STBD1 protein(26-358 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | November 08, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 26-358 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | GPGDTGKDGDAEQEKDAPLGGAAIPGGHQSGSSGLSPGPSGQELVTKPEHLQESNGHLISKTKDLGKLQAASWRLQNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRNESLESPMGEWGFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRVDHEEWEMVPRHSSWGDVGVGGSLKAPVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKVVHAWWGIH |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | STBD1 starch binding domain 1 [ Homo sapiens ] |
| Official Symbol | STBD1 |
| Synonyms | STBD1; starch binding domain 1; starch-binding domain-containing protein 1; FLJ41801; genethonin 1; GENX 3414; GENEX3414; GENX-3414; |
| Gene ID | 8987 |
| mRNA Refseq | NM_003943 |
| Protein Refseq | NP_003934 |
| MIM | 607406 |
| UniProt ID | O95210 |
| ◆ Recombinant Proteins | ||
| STBD1-2999H | Recombinant Human STBD1 protein, GST-tagged | +Inquiry |
| STBD1-16116M | Recombinant Mouse STBD1 Protein | +Inquiry |
| STBD1-8791M | Recombinant Mouse STBD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| STBD1-4521R | Recombinant Rhesus monkey STBD1 Protein, His-tagged | +Inquiry |
| RFL23317HF | Recombinant Full Length Human Starch-Binding Domain-Containing Protein 1(Stbd1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STBD1-694HCL | Recombinant Human STBD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STBD1 Products
Required fields are marked with *
My Review for All STBD1 Products
Required fields are marked with *
