Recombinant Human STC1 Protein, GST-tagged
| Cat.No. : | STC1-1377H |
| Product Overview : | Recombinant Human STC1 Protein (39-247aa) was expressed in E. coli with N-terminal GST tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 39-247 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 50.6 kDa |
| AA Sequence : | SAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVF LAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTI RDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | STC1 stanniocalcin 1 [ Homo sapiens ] |
| Official Symbol | STC1 |
| Synonyms | STC1; stanniocalcin 1; STC; stanniocalcin-1 |
| Gene ID | 6781 |
| mRNA Refseq | NM_003155 |
| Protein Refseq | NP_003146 |
| MIM | 601185 |
| UniProt ID | P52823 |
| ◆ Recombinant Proteins | ||
| STC1-01H | Active Recombinant Human STC1 Protein, His-tagged | +Inquiry |
| STC1-5442R | Recombinant Rat STC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| STC1-3535H | Recombinant Human STC1 protein, His-SUMO-tagged | +Inquiry |
| STC1-8131H | Recombinant Human STC1 protein, His & GST-tagged | +Inquiry |
| STC1-16117M | Recombinant Mouse STC1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STC1-1412HCL | Recombinant Human STC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STC1 Products
Required fields are marked with *
My Review for All STC1 Products
Required fields are marked with *
