"STEAP2" Related Products

Recombinant Human STEAP2 protein, GST-tagged

Cat.No.: STEAP2-15H
Product Overview: Recombinant Human STEAP2(1 a.a. - 490 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene is a member of the STEAP family and encodes a multi-pass membrane protein that localizes to the Golgi complex, the plasma membrane, and the vesicular tubular structures in the cytosol. A highly similar protein in mouse has both ferrireductase and cupric reductase activity, and stimulates the cellular uptake of both iron and copper in vitro. Increased transcriptional expression of the human gene is associated with prostate cancer progression. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 80.85 kDa
AA Sequence: MESISMMGSPKSLSETFLPNGINGIKDARKVTVGVIGSGDFAKSLTIRLIRCGYHVVIGSRNPKFASEFFPHVVD VTHHEDALTKTNIIFVAIHREHYTSLWDLRHLLVGKILIDVSNNMRINQYPESNAEYLASLFPDSLIVKGFNVVS AWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIENLPLRLFTLWRGPVVVAISLATF FFLYSFVRDVIHPYARNQQSDFYKIPIEIVNKTLPIVAITLLSLVYLAGLLAAAYQLYYGTKYRRFPPWLETWLQ CRKQLGLLSFFFAMVHVAYSLCLPMRRSERYLFLNMAYQQVHANIENSWNEEEVWRIEMYISFGIMSLGLLSLLA VTSIPSVSNALNWREFSFIQSTLGYVALLISTFHVLIYGWKRAFEEEYYRFYTPPNFVLALVLPSIVILGKIILF LPCISRKLKRIKKGWEKSQFLEEGMGGTIPHVSPERVTVM
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: STEAP2 STEAP family member 2, metalloreductase [ Homo sapiens ]
Official Symbol: STEAP2
Synonyms: STEAP2; STEAP family member 2, metalloreductase; PCANAP1, prostate cancer associated protein 1 , six transmembrane epithelial antigen of the prostate 2; metalloreductase STEAP2; IPCA 1; STAMP1; STMP; prostate cancer associated protein 1; prostate cancer-associated protein 1; SixTransMembrane Protein of Prostate 1; protein upregulated in metastatic prostate cancer; protein up-regulated in metastatic prostate cancer; six transmembrane epithelial antigen of prostate 2; six-transmembrane epithelial antigen of prostate 2; six transmembrane epithelial antigen of the prostate 2; IPCA1; PUMPCn; PCANAP1;
Gene ID: 261729
mRNA Refseq: NM_001040665
Protein Refseq: NP_001035755
MIM: 605094
UniProt ID: Q8NFT2
Chromosome Location: 7q21.13
Pathway: Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem;
Function: electron carrier activity; flavin adenine dinucleotide binding; iron ion binding; metal ion binding; nucleotide binding; oxidoreductase activity; transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.