Recombinant Human STEAP2 protein, GST-tagged
| Cat.No. : | STEAP2-15H |
| Product Overview : | Recombinant Human STEAP2(1 a.a. - 490 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
| Availability | January 15, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-490 a.a. |
| Description : | This gene is a member of the STEAP family and encodes a multi-pass membrane protein that localizes to the Golgi complex, the plasma membrane, and the vesicular tubular structures in the cytosol. A highly similar protein in mouse has both ferrireductase and cupric reductase activity, and stimulates the cellular uptake of both iron and copper in vitro. Increased transcriptional ex |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 80.85 kDa |
| AA Sequence : | MESISMMGSPKSLSETFLPNGINGIKDARKVTVGVIGSGDFAKSLTIRLIRCGYHVVIGSRNPKFASEFFPHVVD VTHHEDALTKTNIIFVAIHREHYTSLWDLRHLLVGKILIDVSNNMRINQYPESNAEYLASLFPDSLIVKGFNVVS AWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIENLPLRLFTLWRGPVVVAISLATF FFLYSFVRDVIHPYARNQQSDFYKIPIEIVNKTLPIVAITLLSLVYLAGLLAAAYQLYYGTKYRRFPPWLETWLQ CRKQLGLLSFFFAMVHVAYSLCLPMRRSERYLFLNMAYQQVHANIENSWNEEEVWRIEMYISFGIMSLGLLSLLA VTSIPSVSNALNWREFSFIQSTLGYVALLISTFHVLIYGWKRAFEEEYYRFYTPPNFVLALVLPSIVILGKIILF LPCISRKLKRIKKGWEKSQFLEEGMGGTIPHVSPERVTVM |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | STEAP2 STEAP family member 2, metalloreductase [ Homo sapiens ] |
| Official Symbol | STEAP2 |
| Synonyms | STEAP2; STEAP family member 2, metalloreductase; PCANAP1, prostate cancer associated protein 1 , six transmembrane epithelial antigen of the prostate 2; metalloreductase STEAP2; IPCA 1; STAMP1; STMP; prostate cancer associated protein 1; prostate cancer-associated protein 1; SixTransMembrane Protein of Prostate 1; protein upregulated in metastatic prostate cancer; protein up-regulated in metastatic prostate cancer; six transmembrane epithelial antigen of prostate 2; six-transmembrane epithelial antigen of prostate 2; six transmembrane epithelial antigen of the prostate 2; IPCA1; PUMPCn; PCANAP1; |
| Gene ID | 261729 |
| mRNA Refseq | NM_001040665 |
| Protein Refseq | NP_001035755 |
| MIM | 605094 |
| UniProt ID | Q8NFT2 |
| Chromosome Location | 7q21.13 |
| Pathway | Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem; |
| Function | electron carrier activity; flavin adenine dinucleotide binding; iron ion binding; metal ion binding; nucleotide binding; oxidoreductase activity; transporter activity; |
| ◆ Recombinant Proteins | ||
| STEAP2-3001H | Recombinant Human STEAP2, His-tagged | +Inquiry |
| RFL27667MF | Recombinant Full Length Mouse Metalloreductase Steap2(Steap2) Protein, His-Tagged | +Inquiry |
| STEAP2-649HF | Recombinant Full Length Human STEAP2 Protein, GST-tagged | +Inquiry |
| STEAP2-2454H | Recombinant Human STEAP2 Full Length Transmembrane protein, His-SUMO-tagged | +Inquiry |
| RFL23588HF | Recombinant Full Length Human Metalloreductase Steap2(Steap2) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STEAP2 Products
Required fields are marked with *
My Review for All STEAP2 Products
Required fields are marked with *
