Recombinant Human STEAP2 protein, GST-tagged

Cat.No. : STEAP2-16H
Product Overview : Recombinant Human STEAP2(2 a.a. - 100 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 2-100 a.a.
Description : This gene is a member of the STEAP family and encodes a multi-pass membrane protein that localizes to the Golgi complex, the plasma membrane, and the vesicular tubular structures in the cytosol. A highly similar protein in mouse has both ferrireductase and cupric reductase activity, and stimulates the cellular uptake of both iron and copper in vitro. Increased transcriptional expression of the human gene is associated with prostate cancer progression. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
AA Sequence : ESISMMGSPKSLSETVLPNGINGIKDARKVTVGVIGSGDFAKSLTIRLIRCGYHVVIGSRNPKFASEFFPHVVDV THHEDALTKTNIIFVAIHREHYTS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name STEAP2 STEAP family member 2, metalloreductase [ Homo sapiens ]
Official Symbol STEAP2
Synonyms STEAP2; STEAP family member 2, metalloreductase; PCANAP1, prostate cancer associated protein 1 , six transmembrane epithelial antigen of the prostate 2; metalloreductase STEAP2; IPCA 1; STAMP1; STMP; prostate cancer associated protein 1; prostate cancer-associated protein 1; SixTransMembrane Protein of Prostate 1; protein upregulated in metastatic prostate cancer; protein up-regulated in metastatic prostate cancer; six transmembrane epithelial antigen of prostate 2; six-transmembrane epithelial antigen of prostate 2; six transmembrane epithelial antigen of the prostate 2; IPCA1; PUMPCn; PCANAP1;
Gene ID 261729
mRNA Refseq NM_152999
Protein Refseq NP_694544
MIM 605094
UniProt ID Q8NFT2
Chromosome Location 7q21.13
Pathway Mineral absorption, organism-specific biosystem; Mineral absorption, conserved biosystem;
Function electron carrier activity; flavin adenine dinucleotide binding; iron ion binding; metal ion binding; nucleotide binding; oxidoreductase activity; transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STEAP2 Products

Required fields are marked with *

My Review for All STEAP2 Products

Required fields are marked with *

0
cart-icon