Recombinant Human STING1 Protein (H232 variant), His-tagged

Cat.No. : STING1-14H
Product Overview : Recombinant STING corresponding to amino acids 139-379 of human STING H232 allele (UniProtKB-Q86WV6) was expressed in E. coli cells and contains a His tag at the N-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Leu139-Ser379
Description : This gene encodes a five transmembrane protein that functions as a major regulator of the innate immune response to viral and bacterial infections. The encoded protein is a pattern recognition receptor that detects cytosolic nucleic acids and transmits signals that activate type I interferon responses. The encoded protein has also been shown to play a role in apoptotic signaling by associating with type II major histocompatibility complex. Mutations in this gene are the cause of infantile-onset STING-associated vasculopathy. Alternate splicing results in multiple transcript variants.
AA Sequence : MGHHHHHHHHGSLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS
Purity : > 90% as analyzed by SDS-PAGE
Notes : This product is for laboratory research use only.
Storage : The product can be stored at -20 centigrade or below. Avoid repeated freezing and thawing cycles.
Storage Buffer : 20 mM Tris-HCl, pH 8.0, 150 mM NaCl, 10% glycerol, 2 mM DTT, 0.1% Tween 20
Gene Name STING1 stimulator of interferon response cGAMP interactor 1 [ Homo sapiens (human) ]
Official Symbol STING1
Synonyms STING1; stimulator of interferon response cGAMP interactor 1; ERIS; MITA; MPYS; SAVI; NET23; STING; hMITA; hSTING; TMEM173; STING-beta; stimulator of interferon genes protein; N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner; endoplasmic reticulum IFN stimulator; endoplasmic reticulum interferon stimulator; mitochondrial mediator of IRF3 activation; stimulator of interferon protein; transmembrane protein 173
Gene ID 340061
mRNA Refseq NM_198282
Protein Refseq NP_938023
MIM 612374
UniProt ID D6RID9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STING1 Products

Required fields are marked with *

My Review for All STING1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon