Recombinant Human STK17A protein, GST-tagged
| Cat.No. : | STK17A-3008H |
| Product Overview : | Recombinant Human STK17A protein(1-326 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-326 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MIPLEKPGSGGSSPGATSGSGRAGRGLSGPCRPPPPPQARGLLTEIRAVVRTEPFQDGYSLCPGRELGRGKFAVVRKCIKKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLELAQDNPWVINLHEVYETASEMILVLEYAAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSESPLGDIKIVDFGLSRILKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVLTYVMLTGISPFLGNDKQETFLNISQMNLSYSEEEFDVLSESAVDFIRTLLVKKPEDRATAEECLKHPWLTQSSI |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | STK17A serine/threonine kinase 17a [ Homo sapiens ] |
| Official Symbol | STK17A |
| Synonyms | STK17A; serine/threonine kinase 17a; serine/threonine kinase 17a (apoptosis inducing); serine/threonine-protein kinase 17A; death associated protein kinase related 1; DRAK1; death-associated protein kinase-related 1; serine/threonine kinase 17a (apoptosis-inducing); DAP kinase-related apoptosis-inducing protein kinase 1; |
| Gene ID | 9263 |
| mRNA Refseq | NM_004760 |
| Protein Refseq | NP_004751 |
| MIM | 604726 |
| UniProt ID | Q9UEE5 |
| ◆ Recombinant Proteins | ||
| STK17A-2600HF | Active Recombinant Full Length Human STK17A Protein, GST-tagged | +Inquiry |
| STK17A-5111H | Recombinant Human STK17A, His-tagged | +Inquiry |
| STK17A-3008H | Recombinant Human STK17A protein, GST-tagged | +Inquiry |
| STK17A-5496Z | Recombinant Zebrafish STK17A | +Inquiry |
| STK17A-65HFL | Active Recombinant Full Length Human STK17A Protein, N-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STK17A-1712HCL | Recombinant Human STK17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STK17A Products
Required fields are marked with *
My Review for All STK17A Products
Required fields are marked with *
