Recombinant Human STK35 protein, His-tagged
| Cat.No. : | STK35-2844H |
| Product Overview : | Recombinant Human STK35 protein(1-75 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-75 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | METGKDGARRGTQSPERKRRSPVPRAPSTKLRPAAAARAMDPVAAEAPGEAFLARRRPEGGGGSARPRYSLLAEI |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | STK35 serine/threonine kinase 35 [ Homo sapiens ] |
| Official Symbol | STK35 |
| Synonyms | STK35; serine/threonine kinase 35; serine/threonine-protein kinase 35; bA550O8.2; CLIK1; CLP 36 interacting kinase; CLIK-1; CLP-36 interacting kinase; CLP-36-interacting kinase 1; PDLIM1-interacting kinase 1; serine threonine kinase 35 long form; serine/threonine-protein kinase 35 L1; STK35L1; |
| Gene ID | 140901 |
| mRNA Refseq | NM_080836 |
| Protein Refseq | NP_543026 |
| MIM | 609370 |
| UniProt ID | Q8TDR2 |
| ◆ Recombinant Proteins | ||
| STK35-7021H | Recombinant Human STK35 , GST-tagged | +Inquiry |
| STK35-4809Z | Recombinant Zebrafish STK35 | +Inquiry |
| STK35-59HFL | Active Recombinant Full Length Human STK35 Protein, N-His-tagged | +Inquiry |
| STK35-2844H | Recombinant Human STK35 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STK35 Products
Required fields are marked with *
My Review for All STK35 Products
Required fields are marked with *
