Recombinant Human STK40, His-tagged
| Cat.No. : | STK40-29510TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 357-435 of Human STK40 with a N terminal His tag; predicted MWt 10kDa: |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 357-435 a.a. |
| Description : | Serine/threonine-protein kinase 40 is an enzyme that in humans is encoded by the STK40 gene. |
| Conjugation : | HIS |
| Form : | Lyophilised:reconstitution with 75 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | NADSSQEAKVTEECSQYEFENYMRQQLLLAEEKSSIHDAR SWVPKRQFGSAPPVRRLGHDAQPMTSLDTAILAQRYLR K |
| Gene Name | STK40 serine/threonine kinase 40 [ Homo sapiens ] |
| Official Symbol | STK40 |
| Synonyms | STK40; serine/threonine kinase 40; serine/threonine-protein kinase 40; MGC4796; SgK495; |
| Gene ID | 83931 |
| mRNA Refseq | NM_032017 |
| Protein Refseq | NP_114406 |
| MIM | 609437 |
| Uniprot ID | Q8N2I9 |
| Chromosome Location | 1p34.3 |
| Function | ATP binding; nucleotide binding; protein serine/threonine kinase activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STK40 Products
Required fields are marked with *
My Review for All STK40 Products
Required fields are marked with *
