Recombinant Human STMN1, GST-tagged

Cat.No. : STMN1-364H
Product Overview : Recombinant Human STMN1(1 a.a. - 149 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 43.7 kDa
AA Sequence : MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEK REHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name STMN1 stathmin 1 [ Homo sapiens ]
Official Symbol STMN1
Synonyms STMN1; LAP18; Lag; OP18; PP17; PP19; PR22; SMN; stathmin 1; Lag; SMN; LAP18; C1orf215; FLJ32206; MGC138869; MGC138870; prosolin; metablastin; oncoprotein 18; phosphoprotein 19; OTTHUMP00000008527; OTTHUMP00000008528; OTTHUMP00000008530; stathmin 1/oncoprotein 18; leukemia-associated phosphoprotein p18; Metablastin; pp17; pp19; Protein Pr22; chromosome 1 open reading frame 215
Gene ID 3925
mRNA Refseq NM_005563
Protein Refseq NP_005554
MIM 151442
UniProt ID P16949
Chromosome Location 19p13.3
Pathway Aurora B signaling; MAPK signaling pathway; MicroRNAs in cancer
Function signal transducer activity; tubulin binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STMN1 Products

Required fields are marked with *

My Review for All STMN1 Products

Required fields are marked with *

0
cart-icon