Recombinant Human STMN1 protein, GST-tagged
Cat.No. : | STMN1-361H |
Product Overview : | Recombinant Human STMN1 protein(NP_001138926)(1-149 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-149 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDFSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | STMN1 stathmin 1 [ Homo sapiens ] |
Official Symbol | STMN1 |
Synonyms | STMN1; stathmin 1; C1orf215, chromosome 1 open reading frame 215 , LAP18, stathmin 1/oncoprotein 18; stathmin; FLJ32206; Lag; oncoprotein 18; OP18; PP17; PP19; PR22; SMN; prosolin; metablastin; phosphoprotein 19; phosphoprotein p19; stathmin 1/oncoprotein 18; transmembrane protein C1orf215; leukemia-associated phosphoprotein p18; LAP18; C1orf215; MGC138869; MGC138870; |
Gene ID | 3925 |
mRNA Refseq | NM_001145454 |
Protein Refseq | NP_001138926 |
MIM | 151442 |
UniProt ID | P16949 |
◆ Recombinant Proteins | ||
STMN1-8814M | Recombinant Mouse STMN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
STMN1-2128H | Recombinant Human STMN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Stmn1-1287M | Recombinant Mouse Stmn1 Protein, MYC/DDK-tagged | +Inquiry |
STMN1-3654H | Recombinant Human STMN1 protein, His-tagged | +Inquiry |
STMN1-2900H | Recombinant Human STMN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
STMN1-1397HCL | Recombinant Human STMN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STMN1 Products
Required fields are marked with *
My Review for All STMN1 Products
Required fields are marked with *
0
Inquiry Basket