Recombinant Human STMN1 protein, GST-tagged

Cat.No. : STMN1-361H
Product Overview : Recombinant Human STMN1 protein(NP_001138926)(1-149 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-149 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDFSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
Concentration : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name STMN1 stathmin 1 [ Homo sapiens ]
Official Symbol STMN1
Synonyms STMN1; stathmin 1; C1orf215, chromosome 1 open reading frame 215 , LAP18, stathmin 1/oncoprotein 18; stathmin; FLJ32206; Lag; oncoprotein 18; OP18; PP17; PP19; PR22; SMN; prosolin; metablastin; phosphoprotein 19; phosphoprotein p19; stathmin 1/oncoprotein 18; transmembrane protein C1orf215; leukemia-associated phosphoprotein p18; LAP18; C1orf215; MGC138869; MGC138870;
Gene ID 3925
mRNA Refseq NM_001145454
Protein Refseq NP_001138926
MIM 151442
UniProt ID P16949

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STMN1 Products

Required fields are marked with *

My Review for All STMN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon