Recombinant Human STMN3, His-tagged
| Cat.No. : | STMN3-31471TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 27-180 of Human STMN3 with N terminal His tag; 154 amino acids, 25.7kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 27-180 a.a. |
| Description : | The protein encoded by this gene belongs to the stathmin/oncoprotein 18 family of microtubule-destabilizing phosphoproteins. It is similar to the SCG10 protein and is involved in signal transduction and regulation of microtubule dynamics. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 164 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | TQPHPNTVYQYGDMEVKQLDKRASGQSFEVILKSPSDLSP ESPMLSSPPKKKDTSLEELQKRLEAAEERRKTQEAQVL KQLAERREHEREVLHKALEENNNFSRQAEEKLNYKMEL SKEIREAHLAALRERLREKELHAAEVRRNKEQREEMSG |
| Gene Name | STMN3 stathmin-like 3 [ Homo sapiens ] |
| Official Symbol | STMN3 |
| Synonyms | STMN3; stathmin-like 3; stathmin-3; SCLIP; |
| Gene ID | 50861 |
| mRNA Refseq | NM_015894 |
| Protein Refseq | NP_056978 |
| MIM | 608362 |
| Uniprot ID | Q9NZ72 |
| Chromosome Location | 20q13.3 |
| Function | protein domain specific binding; |
| ◆ Recombinant Proteins | ||
| STMN3-31470TH | Recombinant Human STMN3, His-tagged | +Inquiry |
| STMN3-1212C | Recombinant Chicken STMN3 | +Inquiry |
| STMN3-31471TH | Recombinant Human STMN3, His-tagged | +Inquiry |
| STMN3-985C | Recombinant Cynomolgus STMN3 Protein, His-tagged | +Inquiry |
| STMN3-5457R | Recombinant Rat STMN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STMN3-1395HCL | Recombinant Human STMN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STMN3 Products
Required fields are marked with *
My Review for All STMN3 Products
Required fields are marked with *
