Recombinant Human STX17 Full Length Transmembrane protein, His-tagged
| Cat.No. : | STX17-121H |
| Product Overview : | Recombinant Human STX17 protein(P56962)(2-302aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-302aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 34.8 kDa |
| AA Sequence : | SEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEEGTKNLGKAAKYKLAALPVAGALIGGMVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRKKQKMMEKLTSSCPDLPSQTDKKCS |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | STX17 syntaxin 17 [ Homo sapiens ] |
| Official Symbol | STX17 |
| Synonyms | STX17; syntaxin 17; FLJ20651; |
| Gene ID | 9485 |
| MIM | 604204 |
| UniProt ID | P56962 |
| ◆ Recombinant Proteins | ||
| STX17-16184M | Recombinant Mouse STX17 Protein | +Inquiry |
| STX17-5468R | Recombinant Rat STX17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| STX17-1825Z | Recombinant Zebrafish STX17 | +Inquiry |
| STX17-2690C | Recombinant Chicken STX17 | +Inquiry |
| RFL21836HF | Recombinant Full Length Human Syntaxin-17(Stx17) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STX17 Products
Required fields are marked with *
My Review for All STX17 Products
Required fields are marked with *
