Recombinant Human STX17 protein, His-tagged
Cat.No. : | STX17-244H |
Product Overview : | Recombinant Human STX17 protein(1-216 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-216 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MSEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCGIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | STX17 syntaxin 17 [ Homo sapiens ] |
Official Symbol | STX17 |
Synonyms | STX17; syntaxin 17; FLJ20651; |
Gene ID | 9485 |
MIM | 604204 |
UniProt ID | P56962 |
◆ Recombinant Proteins | ||
STX17-4544R | Recombinant Rhesus monkey STX17 Protein, His-tagged | +Inquiry |
STX17-3025H | Recombinant Human STX17, GST-tagged | +Inquiry |
RFL13619MF | Recombinant Full Length Mouse Syntaxin-17(Stx17) Protein, His-Tagged | +Inquiry |
RFL34320BF | Recombinant Full Length Bovine Syntaxin-17(Stx17) Protein, His-Tagged | +Inquiry |
STX17-2344H | Recombinant Human STX17, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STX17 Products
Required fields are marked with *
My Review for All STX17 Products
Required fields are marked with *
0
Inquiry Basket