Recombinant Human STX17 protein, His-tagged
| Cat.No. : | STX17-244H |
| Product Overview : | Recombinant Human STX17 protein(1-216 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-216 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MSEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCGIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEE |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
| Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | STX17 syntaxin 17 [ Homo sapiens ] |
| Official Symbol | STX17 |
| Synonyms | STX17; syntaxin 17; FLJ20651; |
| Gene ID | 9485 |
| MIM | 604204 |
| UniProt ID | P56962 |
| ◆ Recombinant Proteins | ||
| STX17-2344H | Recombinant Human STX17, His-tagged | +Inquiry |
| STX17-5468R | Recombinant Rat STX17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL21836HF | Recombinant Full Length Human Syntaxin-17(Stx17) Protein, His-Tagged | +Inquiry |
| STX17-16184M | Recombinant Mouse STX17 Protein | +Inquiry |
| STX17-4360R | Recombinant Rhesus Macaque STX17 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STX17 Products
Required fields are marked with *
My Review for All STX17 Products
Required fields are marked with *



