Recombinant Human STX1A Protein, His-tagged
Cat.No. : | STX1A-6375H |
Product Overview : | Recombinant Human STX1A protein(Met1-Val255), fused with N-terminal His tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Met1-Val255 |
Tag : | N-His |
Form : | Liquid in sterile PBS, pH7.4. |
Molecular Mass : | The protein has a calculated MW of 32 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 80 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.0 mg/ml. |
Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMMKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAV |
Gene Name | STX1A syntaxin 1A (brain) [ Homo sapiens ] |
Official Symbol | STX1A |
Synonyms | STX1A; syntaxin 1A (brain); STX1; syntaxin-1A; HPC 1; p35 1; neuron-specific antigen HPC-1; HPC-1; P35-1; SYN1A; |
Gene ID | 6804 |
mRNA Refseq | NM_001165903 |
Protein Refseq | NP_001159375 |
MIM | 186590 |
UniProt ID | Q16623 |
◆ Recombinant Proteins | ||
STX1A-4546R | Recombinant Rhesus monkey STX1A Protein, His-tagged | +Inquiry |
RFL33813RF | Recombinant Full Length Rat Syntaxin-1A(Stx1A) Protein, His-Tagged | +Inquiry |
STX1A-16187M | Recombinant Mouse STX1A Protein | +Inquiry |
STX1A-13H | Recombinant Human Syntaxin 1A protein, 1-265aa | +Inquiry |
STX1A-2988H | Recombinant Human STX1A Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STX1A-1717HCL | Recombinant Human STX1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STX1A Products
Required fields are marked with *
My Review for All STX1A Products
Required fields are marked with *