Recombinant Human STX1A Protein, His-tagged

• Cat.No.: STX1A-6375H
• Product Overview: Recombinant Human STX1A protein(Met1-Val255), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Met1-Val255
• Tag: N-His
• Form: Liquid in sterile PBS, pH7.4.
• Molecular Mass: The protein has a calculated MW of 32 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 80 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.0 mg/ml.
• Reconstitution: Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMMKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAV

Gene Information

• Gene Name: STX1A syntaxin 1A (brain) [ Homo sapiens ]
• Official Symbol: STX1A
• Synonyms: STX1A; syntaxin 1A (brain); STX1; syntaxin-1A; HPC 1; p35 1; neuron-specific antigen HPC-1; HPC-1; P35-1; SYN1A
• Gene ID: 6804
• mRNA Refseq: NM_001165903
• Protein Refseq: NP_001159375
• MIM: 186590
• UniProt ID: Q16623