Recombinant Human STX1A Protein, His-tagged

Cat.No. : STX1A-6375H
Product Overview : Recombinant Human STX1A protein(Met1-Val255), fused with N-terminal His tag, was expressed in E. coli.
Availability August 28, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Met1-Val255
Tag : N-His
Form : Liquid in sterile PBS, pH7.4.
Molecular Mass : The protein has a calculated MW of 32 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 80 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.0 mg/ml.
Reconstitution : Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MGSSHHHHHHSSGLVPRGSHMMKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAV
Gene Name STX1A syntaxin 1A (brain) [ Homo sapiens ]
Official Symbol STX1A
Synonyms STX1A; syntaxin 1A (brain); STX1; syntaxin-1A; HPC 1; p35 1; neuron-specific antigen HPC-1; HPC-1; P35-1; SYN1A;
Gene ID 6804
mRNA Refseq NM_001165903
Protein Refseq NP_001159375
MIM 186590
UniProt ID Q16623

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STX1A Products

Required fields are marked with *

My Review for All STX1A Products

Required fields are marked with *

0
cart-icon