Recombinant Human STX1A Protein, His-tagged
| Cat.No. : | STX1A-6375H |
| Product Overview : | Recombinant Human STX1A protein(Met1-Val255), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | June 12, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Met1-Val255 |
| Tag : | N-His |
| Form : | Liquid in sterile PBS, pH7.4. |
| Molecular Mass : | The protein has a calculated MW of 32 kDa. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 80 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.0 mg/ml. |
| Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMMKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAV |
| Gene Name | STX1A syntaxin 1A (brain) [ Homo sapiens ] |
| Official Symbol | STX1A |
| Synonyms | STX1A; syntaxin 1A (brain); STX1; syntaxin-1A; HPC 1; p35 1; neuron-specific antigen HPC-1; HPC-1; P35-1; SYN1A; |
| Gene ID | 6804 |
| mRNA Refseq | NM_001165903 |
| Protein Refseq | NP_001159375 |
| MIM | 186590 |
| UniProt ID | Q16623 |
| ◆ Recombinant Proteins | ||
| STX1A-8249H | Recombinant Human STX1A protein, His & T7-tagged | +Inquiry |
| RFL33813RF | Recombinant Full Length Rat Syntaxin-1A(Stx1A) Protein, His-Tagged | +Inquiry |
| STX1A-5811R | Recombinant Rat STX1A Protein | +Inquiry |
| STX1A-214H | Recombinant Human STX1A | +Inquiry |
| STX1A-5470R | Recombinant Rat STX1A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STX1A-1717HCL | Recombinant Human STX1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STX1A Products
Required fields are marked with *
My Review for All STX1A Products
Required fields are marked with *
