Recombinant Human STX1B protein, His-tagged
Cat.No. : | STX1B-582H |
Product Overview : | Recombinant Human STX1B protein(NP_443106.1)(1-263 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-263 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | STX1B syntaxin 1B [ Homo sapiens ] |
Official Symbol | STX1B |
Synonyms | STX1B1; STX1B2 |
Gene ID | 112755 |
mRNA Refseq | NM_052874.3 |
Protein Refseq | NP_443106.1 |
MIM | 601485 |
UniProt ID | P61266 |
◆ Recombinant Proteins | ||
STX1B-16188M | Recombinant Mouse STX1B Protein | +Inquiry |
STX1B-9072Z | Recombinant Zebrafish STX1B | +Inquiry |
RFL22007HF | Recombinant Full Length Human Syntaxin-1B(Stx1B) Protein, His-Tagged | +Inquiry |
RFL15638OF | Recombinant Full Length Sheep Syntaxin-1B(Stx1B) Protein, His-Tagged | +Inquiry |
STX1B-3065H | Recombinant Human STX1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
STX1B-1377HCL | Recombinant Human STX1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STX1B Products
Required fields are marked with *
My Review for All STX1B Products
Required fields are marked with *
0
Inquiry Basket