Recombinant Human STX8 Protein

• Cat.No.: STX8-545H
• Product Overview: Recombinant Human STX8 was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: Vesicle trafficking protein that functions in the early secretory pathway, possibly by mediating retrograde transport from cis-Golgi membranes to the ER.
• Form: Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
• Molecular Mass: 24.6kD
• AA Sequence: MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCG
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: STX8 syntaxin 8 [ Homo sapiens ]
• Official Symbol: STX8
• Synonyms: STX8; syntaxin 8; syntaxin-8; CARB; CIP-1-associated regulator of cyclin B
• Gene ID: 9482
• mRNA Refseq: NM_004853
• Protein Refseq: NP_004844
• MIM: 604203
• UniProt ID: Q9UNK0