Recombinant Human STX8 Protein
Cat.No. : | STX8-545H |
Product Overview : | Recombinant Human STX8 was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | Vesicle trafficking protein that functions in the early secretory pathway, possibly by mediating retrograde transport from cis-Golgi membranes to the ER. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 24.6kD |
AA Sequence : | MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCG |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | STX8 syntaxin 8 [ Homo sapiens ] |
Official Symbol | STX8 |
Synonyms | STX8; syntaxin 8; syntaxin-8; CARB; CIP-1-associated regulator of cyclin B; |
Gene ID | 9482 |
mRNA Refseq | NM_004853 |
Protein Refseq | NP_004844 |
MIM | 604203 |
UniProt ID | Q9UNK0 |
◆ Recombinant Proteins | ||
RFL18784MF | Recombinant Full Length Mouse Syntaxin-8(Stx8) Protein, His-Tagged | +Inquiry |
STX8-6705H | Recombinant Human STX8 Protein (Met1-Gly215) | +Inquiry |
STX8-3033H | Recombinant Human STX8, GST-tagged | +Inquiry |
STX8-349H | Recombinant Human STX8, His tagged | +Inquiry |
STX8-2401C | Recombinant Chicken STX8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
STX8-1030HCL | Recombinant Human STX8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STX8 Products
Required fields are marked with *
My Review for All STX8 Products
Required fields are marked with *