Recombinant Human SUCLG2 protein, His-SUMO-tagged

• Cat.No.: SUCLG2-3044H
• Product Overview: Recombinant Human SUCLG2 protein(Q96I99)(49-423aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 49-423aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 56.3kDa
• AA Sequence: MSDNGVRVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SUCLG2 succinate-CoA ligase, GDP-forming, beta subunit [ Homo sapiens ]
• Official Symbol: SUCLG2
• Synonyms: SUCLG2; succinate-CoA ligase, GDP-forming, beta subunit; succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial; SCS-betaG; succinyl-CoA synthetase beta-G chain; succinyl-CoA synthetase, beta-G chain; GTP-specific succinyl-CoA synthetase beta subunit; GTP-specific succinyl-CoA synthetase subunit beta; succinyl-CoA ligase, GDP-forming, beta chain, mitochondrial; GBETA
• Gene ID: 8801
• mRNA Refseq: NM_001177599
• Protein Refseq: NP_001171070
• MIM: 603922
• UniProt ID: Q96I99