Recombinant Human SUCLG2 protein, His-SUMO-tagged
| Cat.No. : | SUCLG2-3044H |
| Product Overview : | Recombinant Human SUCLG2 protein(Q96I99)(49-423aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 49-423aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 56.3kDa |
| AA Sequence : | MSDNGVRVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | SUCLG2 succinate-CoA ligase, GDP-forming, beta subunit [ Homo sapiens ] |
| Official Symbol | SUCLG2 |
| Synonyms | SUCLG2; succinate-CoA ligase, GDP-forming, beta subunit; succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial; SCS-betaG; succinyl-CoA synthetase beta-G chain; succinyl-CoA synthetase, beta-G chain; GTP-specific succinyl-CoA synthetase beta subunit; GTP-specific succinyl-CoA synthetase subunit beta; succinyl-CoA ligase, GDP-forming, beta chain, mitochondrial; GBETA; |
| Gene ID | 8801 |
| mRNA Refseq | NM_001177599 |
| Protein Refseq | NP_001171070 |
| MIM | 603922 |
| UniProt ID | Q96I99 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUCLG2 Products
Required fields are marked with *
My Review for All SUCLG2 Products
Required fields are marked with *



