Recombinant Human SUCLG2 protein, His-SUMO-tagged

Cat.No. : SUCLG2-3044H
Product Overview : Recombinant Human SUCLG2 protein(Q96I99)(49-423aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 49-423aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 56.3kDa
AA Sequence : MSDNGVRVQRFFVADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name SUCLG2 succinate-CoA ligase, GDP-forming, beta subunit [ Homo sapiens ]
Official Symbol SUCLG2
Synonyms SUCLG2; succinate-CoA ligase, GDP-forming, beta subunit; succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial; SCS-betaG; succinyl-CoA synthetase beta-G chain; succinyl-CoA synthetase, beta-G chain; GTP-specific succinyl-CoA synthetase beta subunit; GTP-specific succinyl-CoA synthetase subunit beta; succinyl-CoA ligase, GDP-forming, beta chain, mitochondrial; GBETA;
Gene ID 8801
mRNA Refseq NM_001177599
Protein Refseq NP_001171070
MIM 603922
UniProt ID Q96I99

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SUCLG2 Products

Required fields are marked with *

My Review for All SUCLG2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon