Recombinant Human SUGT1, His-tagged
| Cat.No. : | SUGT1-30460TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 115-365 of Human SUGT1 with N terminal His tag; 272 amino acids with tag, MWt 30.7 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 251 amino acids |
| Description : | This gene is homologous to the yeast gene SGT1, which encodes a protein involved in kinetochore function and required for the G1/S and G2/M transitions. Complementation studies suggest that the human protein has similar functions. Two transcript variants encoding different isoforms have been found for this gene. |
| Conjugation : | HIS |
| Molecular Weight : | 30.700kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMHRVGQAGLQLLTSSDPPALDSQSAGITGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY |
| Sequence Similarities : | Belongs to the SUGT1 family.Contains 1 CS domain.Contains 1 SGS domain.Contains 3 TPR repeats. |
| Gene Name | SUGT1 SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | SUGT1 |
| Synonyms | SUGT1; SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae); suppressor of G2 allele of SKP1 homolog; SGT1; |
| Gene ID | 10910 |
| mRNA Refseq | NM_006704 |
| Protein Refseq | NP_006695 |
| MIM | 604098 |
| Uniprot ID | Q9Y2Z0 |
| Chromosome Location | 13q12.2-q13.3 |
| Pathway | Immune System, organism-specific biosystem; Inflammasomes, organism-specific biosystem; Innate Immune System, organism-specific biosystem; NOD-like receptor signaling pathway, organism-specific biosystem; NOD-like receptor signaling pathway, conserved biosystem; |
| Function | binding; |
| ◆ Recombinant Proteins | ||
| SUGT1-3437H | Recombinant Human SUGT1 protein, His-tagged | +Inquiry |
| SUGT1-5826R | Recombinant Rat SUGT1 Protein | +Inquiry |
| KAT2B-3068H | Active Recombinant Full Length Human KAT2B Protein, His-tagged | +Inquiry |
| SUGT1-404H | Recombinant Human SUGT1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SUGT1-5485R | Recombinant Rat SUGT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SUGT1-1361HCL | Recombinant Human SUGT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUGT1 Products
Required fields are marked with *
My Review for All SUGT1 Products
Required fields are marked with *



