Recombinant Human SUGT1, His-tagged

Cat.No. : SUGT1-30460TH
Product Overview : Recombinant fragment corresponding to amino acids 115-365 of Human SUGT1 with N terminal His tag; 272 amino acids with tag, MWt 30.7 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 251 amino acids
Description : This gene is homologous to the yeast gene SGT1, which encodes a protein involved in kinetochore function and required for the G1/S and G2/M transitions. Complementation studies suggest that the human protein has similar functions. Two transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Molecular Weight : 30.700kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMHRVGQAGLQLLTSSDPPALDSQSAGITGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
Sequence Similarities : Belongs to the SUGT1 family.Contains 1 CS domain.Contains 1 SGS domain.Contains 3 TPR repeats.
Gene Name SUGT1 SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) [ Homo sapiens ]
Official Symbol SUGT1
Synonyms SUGT1; SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae); suppressor of G2 allele of SKP1 homolog; SGT1;
Gene ID 10910
mRNA Refseq NM_006704
Protein Refseq NP_006695
MIM 604098
Uniprot ID Q9Y2Z0
Chromosome Location 13q12.2-q13.3
Pathway Immune System, organism-specific biosystem; Inflammasomes, organism-specific biosystem; Innate Immune System, organism-specific biosystem; NOD-like receptor signaling pathway, organism-specific biosystem; NOD-like receptor signaling pathway, conserved biosystem;
Function binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SUGT1 Products

Required fields are marked with *

My Review for All SUGT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon