Recombinant Human SUGT1 protein, T7-tagged
Cat.No. : | SUGT1-119H |
Product Overview : | Recombinant human SUGT1 fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQENGRGEFAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNY CVAVADAKKSLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDSADANFSVWIKRCQEAQNGSESEVWTH QSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIE IKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYS DGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | SUGT1 SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SUGT1 |
Synonyms | SUGT1; SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae); suppressor of G2 allele of SKP1 homolog; SGT1; SGT1B protein; putative 40-6-3 protein; suppressor of G2 allele of SKP1, S. cerevisiae, homolog of; |
Gene ID | 10910 |
mRNA Refseq | NM_001130912 |
Protein Refseq | NP_001124384 |
MIM | 604098 |
UniProt ID | Q9Y2Z0 |
Chromosome Location | 13q12.2-q13.3 |
Pathway | Immune System, organism-specific biosystem; Inflammasomes, organism-specific biosystem; Innate Immune System, organism-specific biosystem; NOD-like receptor signaling pathway, organism-specific biosystem; NOD-like receptor signaling pathway, conserved biosystem; Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways, organism-specific biosystem; The NLRP3 inflammasome, organism-specific biosystem; |
Function | binding; |
◆ Recombinant Proteins | ||
SUGT1-3437H | Recombinant Human SUGT1 protein, His-tagged | +Inquiry |
SUGT1-16216M | Recombinant Mouse SUGT1 Protein | +Inquiry |
SUGT1-5485R | Recombinant Rat SUGT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SUGT1-404H | Recombinant Human SUGT1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Sugt1-6220M | Recombinant Mouse Sugt1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUGT1-1361HCL | Recombinant Human SUGT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUGT1 Products
Required fields are marked with *
My Review for All SUGT1 Products
Required fields are marked with *