Recombinant Human SUGT1 protein, T7-tagged

Cat.No. : SUGT1-119H
Product Overview : Recombinant human SUGT1 fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQENGRGEFAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNY CVAVADAKKSLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDSADANFSVWIKRCQEAQNGSESEVWTH QSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIE IKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYS DGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name SUGT1 SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) [ Homo sapiens ]
Official Symbol SUGT1
Synonyms SUGT1; SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae); suppressor of G2 allele of SKP1 homolog; SGT1; SGT1B protein; putative 40-6-3 protein; suppressor of G2 allele of SKP1, S. cerevisiae, homolog of;
Gene ID 10910
mRNA Refseq NM_001130912
Protein Refseq NP_001124384
MIM 604098
UniProt ID Q9Y2Z0
Chromosome Location 13q12.2-q13.3
Pathway Immune System, organism-specific biosystem; Inflammasomes, organism-specific biosystem; Innate Immune System, organism-specific biosystem; NOD-like receptor signaling pathway, organism-specific biosystem; NOD-like receptor signaling pathway, conserved biosystem; Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways, organism-specific biosystem; The NLRP3 inflammasome, organism-specific biosystem;
Function binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SUGT1 Products

Required fields are marked with *

My Review for All SUGT1 Products

Required fields are marked with *

0
cart-icon