Recombinant Human SULT1A1, His-tagged

Cat.No. : SULT1A1-30621TH
Product Overview : Recombinant fragment, corresponding to amino acids 26-295 of Human SULT1A1 with N terminal His tag; 270 amino acids, 31kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 26-295 a.a.
Description : Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity.Multiple alternatively spliced variants that encode two isoforms have been identified for this gene.
Conjugation : HIS
Tissue specificity : Liver, lung, adrenal, brain, platelets and skin.
Form : Lyophilised:Reconstitute with 124 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGG DLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPR LLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYH FYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEW WELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEET VDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMR KGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Sequence Similarities : Belongs to the sulfotransferase 1 family.
Gene Name SULT1A1 sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 [ Homo sapiens ]
Official Symbol SULT1A1
Synonyms SULT1A1; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1; STP, STP1; sulfotransferase 1A1; P PST;
Gene ID 6817
mRNA Refseq NM_001055
Protein Refseq NP_001046
MIM 171150
Uniprot ID P50225
Chromosome Location 16p12.1
Pathway Biological oxidations, organism-specific biosystem; Cytosolic sulfonation of small molecules, organism-specific biosystem; Metabolism, organism-specific biosystem; Phase II conjugation, organism-specific biosystem; Sulfur metabolism, organism-specific biosystem;
Function aryl sulfotransferase activity; flavonol 3-sulfotransferase activity; sulfotransferase activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SULT1A1 Products

Required fields are marked with *

My Review for All SULT1A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon