Recombinant Human SULT1A1, His-tagged
Cat.No. : | SULT1A1-30621TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 26-295 of Human SULT1A1 with N terminal His tag; 270 amino acids, 31kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 26-295 a.a. |
Description : | Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity.Multiple alternatively spliced variants that encode two isoforms have been identified for this gene. |
Conjugation : | HIS |
Tissue specificity : | Liver, lung, adrenal, brain, platelets and skin. |
Form : | Lyophilised:Reconstitute with 124 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGG DLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPR LLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYH FYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEW WELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEET VDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMR KGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
Sequence Similarities : | Belongs to the sulfotransferase 1 family. |
Gene Name | SULT1A1 sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 [ Homo sapiens ] |
Official Symbol | SULT1A1 |
Synonyms | SULT1A1; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1; STP, STP1; sulfotransferase 1A1; P PST; |
Gene ID | 6817 |
mRNA Refseq | NM_001055 |
Protein Refseq | NP_001046 |
MIM | 171150 |
Uniprot ID | P50225 |
Chromosome Location | 16p12.1 |
Pathway | Biological oxidations, organism-specific biosystem; Cytosolic sulfonation of small molecules, organism-specific biosystem; Metabolism, organism-specific biosystem; Phase II conjugation, organism-specific biosystem; Sulfur metabolism, organism-specific biosystem; |
Function | aryl sulfotransferase activity; flavonol 3-sulfotransferase activity; sulfotransferase activity; transferase activity; |
◆ Recombinant Proteins | ||
SULT1A1-587H | Recombinant Human SULT1A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SULT1A1-30621TH | Recombinant Human SULT1A1, His-tagged | +Inquiry |
SULT1A1-4738H | Recombinant Human SULT1A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SULT1A1-6376H | Recombinant Human SULT1A1 Protein (Glu2-Leu295), His tagged | +Inquiry |
SULT1A1-5289H | Recombinant Human SULT1A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SULT1A1-1357HCL | Recombinant Human SULT1A1 293 Cell Lysate | +Inquiry |
SULT1A1-1356HCL | Recombinant Human SULT1A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SULT1A1 Products
Required fields are marked with *
My Review for All SULT1A1 Products
Required fields are marked with *